Home 

Gene Symbol:  
BB14905_21673
Organism:  
Bacillus sp. B14905
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
54140..54877 [1], 738 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_01724948.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:738 bp
>BB14905_21673|ThioFinder910 Bacillus sp. B14905
ATGAATGTGTGGAACTTTAAAGGAGAGAGGAATATAGAGAAAAAATTCATTGATTATCATATGATGTCAA
TCAATGAACCTGAATTCACCAATACTCAAGTATATGCGCATAGACCGAGAGAGTTGCAGGAAAATGGCAA
TTATCCGTTAATTGATTTAGATTATACGATTGACGATAATAATATATTTGAAAAAACATTAGGGACGAGA
TATTCGGCAAGGGAACCATTCAAGACGAATGTGAAGGTCGATAAAAAGGTAATGGCACAATTTACTCAAT
TGGCCATGATTGGTGGTGAAAAAGAAAACCGTACATACCCTTCTGGGGGGGCACAGTACTATGTTAATAT
TTATTTTTTATTCAACGAGCAATTGGTAGACGTTGATTTGATAGAGCAGGGGAATATTATGCTGCTGAAT
AGTGATACTCAAAAATTATTAGTTAAACAATACGTGCCGTGGGATGAAATGAGTAAAGCGTTTATCCAAA
AGTATTTGGCAAATACCGCTCAGTTCGCAGTTGCTTTGAGCTGTGATATGTCAGGAATCTCAGGAAAGTA
TACAGATATCTCCTATAAATTGGTTCAACAGGAGGCCGGACATATTGGACAAAATATTCAGTTGGTAGCG
AATTACTTAGGGTTGGAAAGTGTACCATTGGGCGGTTTTTATGATATTGAGTTATCAAAACTTTTGAGTG
ATAACCAAACATCCTTGTATGCATTTCTTATAGGATAG
 Primer design

Protein Sequence:245 a.a.
>BB14905_21673|ThioFinder910 Bacillus sp. B14905
MNVWNFKGERNIEKKFIDYHMMSINEPEFTNTQVYAHRPRELQENGNYPLIDLDYTIDDNNIFEKTLGTR
YSAREPFKTNVKVDKKVMAQFTQLAMIGGEKENRTYPSGGAQYYVNIYFLFNEQLVDVDLIEQGNIMLLN
SDTQKLLVKQYVPWDEMSKAFIQKYLANTAQFAVALSCDMSGISGKYTDISYKLVQQEAGHIGQNIQLVA
NYLGLESVPLGGFYDIELSKLLSDNQTSLYAFLIG