Home 

Gene Symbol:  
BB14905_21658
Organism:  
Bacillus sp. B14905
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
50416..52089 [1], 1674 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_01724945.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1674 bp
>BB14905_21658|ThioFinder907 Bacillus sp. B14905
ATGACCATACAAACAAACATTGCTACGATTCTGACAAACCAAAAGTATATTTTTATTCATTCATCAAAGA
ATGATTCATTCTTTTGCCTAGATTGCTTTAAGGAGCGAACAAAAGAACTGAAAAGCTATCAACAATATTT
TGGTTGGCAAGAAGACCAGCCAAATCGATTAGAATCAGAAATAATTGATACACTTGTGCAAAAGCTCCAA
ACAAATAGCGAACCGTTCCTCTATGAAATAAACCGAGATACATTGGAAATCCAAGCGAAAGCAACCTTCA
AGCGAGGAGATTGTCAGTGTAATGTAGATACGGGTTCAAATCGACCTCAGGAATTGGATACTCTATTCAA
TGCAAAAGATAATCGACAATTGAGCTTTGAACAAGTAAGAGAAAAGATTGAAAGAAATAAAAAATTAATC
TATGCGCATCCATCGTCGATTGTAAATGCATTGGCTCGCTCCGGCGATTCTTATGGAACACCAATGGTTC
AGACAGAAGTATTGTATAAGGGAATATCAATGCTTTCCTATGGTCGGACAGGGACGTATGAAAAGTCAAA
ATATATTTCTATTTTGGAATCATTGGAGCGCTATGCCACAGCGTTTCCTTATAAAAAGCAACAAAGGGCA
ATGCGGGAAAAAGATTCTGAAGTGATTGATCTCACACTGAGTGAAGTGATGGCACAATGCAATTATGGCA
ATCCAGAAAATTACTCGGAAGATCAGCCACTGAATTATGAAAAAGTTTGGGCATTGCATAGTGAAAGAGA
TGTTCTAATTCCCGAGCAGCTAATTTATTACAACTCTCATGTTGTTTCTAATGAAAAAAGATATATTTAC
GAAAGCTCTAATGGCAGTGCTCTCGGTTCAACAGAAGCAGAGGCCAGCCTACACGCGATGCTAGAGCTGA
TTGAACGCGATGCTTTTTTAGCTACTTGGTATGGACAGATTCCACCTGTCAGAATTGATGAATCTAGCAT
TCATTCTAAAAAAATTCAGGCTTATTTGGACTCTTTAAAGCAAAAAAACATCCGTGTACATTTGTTTGAT
ATATCGATGGAAGTGAAAATTCCGACAATCTGGGTTTTATTAGAAAAAGAGGAGCCTAAGGAAAATGAAA
TGGCCTTCTACACGGCTGCGGCGGCTTCCTTTGACTTGGAAGAGTCAATCGAGCGAGCGTTGATTGAAGC
TACAACTGCGATTACTGTTTTTACAAATGTCTTCAATAATAAGGAATATCAGACAAGGAAACGACAATTG
TTGGACAATCCTCAATCGGTGCACAAGTTGGAAGACCACTTGCTACTTTACTCAAACAAGGAGATGAAAT
ATGCATTTTCGTTTGCATTGAATACAGAAATGGTGTCTTCCTACGAGCAATTGGAGGCTGGGTATACAGT
ATATCAAGGGAAATTTTCCGAGGTTGTTCGAACGCTTGAAGGCCAATTGGTCGATATATCTGGTAAAGCG
TATCGGGCTATGACAGAAAATCCGAATTTATTTTCTGCAGGATTTGTAAATGTGAAATATATAGTGCCTG
GCATGCTGACGATGACTTTTGGGCATCAAAATAGACGAGTTGTCAGTCAACGAATTGAAAAGGCTATTCA
GTTTAAGAAGACAGGGAAGCTAGATAAAGACTGGATAGAGAAAACACCCCATCCATTTCCATAA
 Primer design

Protein Sequence:557 a.a.
>BB14905_21658|ThioFinder907 Bacillus sp. B14905
MTIQTNIATILTNQKYIFIHSSKNDSFFCLDCFKERTKELKSYQQYFGWQEDQPNRLESEIIDTLVQKLQ
TNSEPFLYEINRDTLEIQAKATFKRGDCQCNVDTGSNRPQELDTLFNAKDNRQLSFEQVREKIERNKKLI
YAHPSSIVNALARSGDSYGTPMVQTEVLYKGISMLSYGRTGTYEKSKYISILESLERYATAFPYKKQQRA
MREKDSEVIDLTLSEVMAQCNYGNPENYSEDQPLNYEKVWALHSERDVLIPEQLIYYNSHVVSNEKRYIY
ESSNGSALGSTEAEASLHAMLELIERDAFLATWYGQIPPVRIDESSIHSKKIQAYLDSLKQKNIRVHLFD
ISMEVKIPTIWVLLEKEEPKENEMAFYTAAAASFDLEESIERALIEATTAITVFTNVFNNKEYQTRKRQL
LDNPQSVHKLEDHLLLYSNKEMKYAFSFALNTEMVSSYEQLEAGYTVYQGKFSEVVRTLEGQLVDISGKA
YRAMTENPNLFSAGFVNVKYIVPGMLTMTFGHQNRRVVSQRIEKAIQFKKTGKLDKDWIEKTPHPFP