Home 

Gene Symbol:  
BB14905_21633
Organism:  
Bacillus sp. B14905
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
44013..45050 [1], 1038 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_01724940.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1038 bp
>BB14905_21633|ThioFinder902 Bacillus sp. B14905
ATGTATCAAACCTGTATTTATAACTATGACAGTTCATTAGAACAATCATTGCTATTACTTATTGATGAGT
TGTGGGATAAACATCAATATTTTGTGTCAAAAGGCTGGGAGGGGGGACCGCATATTCAGTTGATTACAAA
AAATAAAATTTCACAATCTGAATATGACACTTTGAAAAAAAGAGTGCGCCAGCTAATCGAAGAACAGCCA
TTGGATAAATCATATATTGATCAAGTGAAGAAAAAATATGAGCAAAGCTCCCGATTGCTATCAAATTTAG
AAAATAAGAAAAATGAACGAGCTATTCGAGAACACGGGGAAATGGACATATATCCTTATAATTTGCCTGT
TCATAATGAACGTTTAACGAATTTATATATGAACGAACGATTCAGACATTACCCATTGCTATTGGATACT
CGAAACTATATAGAAGCACAGAACATTAGCGTTGAGGAGCTGTTTCCCCTTATTTTTTCGAGAATTTCAG
ATGTCTATCATGAAAAGAATAATAATAAAGGGTATTTTTCGTTTGTCTCGCATGTTCAGGGCTTCTTTGA
GCTTTCTGCCAAGCAAGAGAAACCATATACCGAAAAGTTATTTGAGACATTTTATTTAGAAAAACAATCA
GGTTTAGAAGCTGCGGAGAAAGCACATTCTCCAATAATCAATAGATGGTTTAACTATTTTACAGAGTTCT
ATGGAAGTTGTTTAAGTCAGGTGGATGAATTGTTAGACGATCACTATAAAGCGGAATTGACTCGTACTAT
TGAGGAATTAGAGAAGAATTTTAAAAATGAATTTCATAGGAATTTTGTTGCCTATTCAAAGGAAAATAAC
TTTATGGAAAAACCTGAGGCAACGGCTTATAGATTTACCGTAAATCTGCTGTATATACTATTACCTTACT
TTAATATAAGTGCTTTGAAGAAGCAAAAGTATATTTATATGGCTTACAGAATTGTGGAAAGTAAAAAAGG
GATGACTTGGAGGGAGGAGTTAGGACTTGACTATAATCGTTACTCAAAATCCATTTAG
 Primer design

Protein Sequence:345 a.a.
>BB14905_21633|ThioFinder902 Bacillus sp. B14905
MYQTCIYNYDSSLEQSLLLLIDELWDKHQYFVSKGWEGGPHIQLITKNKISQSEYDTLKKRVRQLIEEQP
LDKSYIDQVKKKYEQSSRLLSNLENKKNERAIREHGEMDIYPYNLPVHNERLTNLYMNERFRHYPLLLDT
RNYIEAQNISVEELFPLIFSRISDVYHEKNNNKGYFSFVSHVQGFFELSAKQEKPYTEKLFETFYLEKQS
GLEAAEKAHSPIINRWFNYFTEFYGSCLSQVDELLDDHYKAELTRTIEELEKNFKNEFHRNFVAYSKENN
FMEKPEATAYRFTVNLLYILLPYFNISALKKQKYIYMAYRIVESKKGMTWREELGLDYNRYSKSI