Home 

Gene Symbol:  
BCE_G9241_0525
Organism:  
Bacillus cereus G9241
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
42802..43668 [1], 867 bp
Product Function:  
lantibiotic biosynthesis protein, putative
Product Locus:  
 ZP_00237845.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:867 bp
>BCE_G9241_0525|ThioFinder889 Bacillus cereus G9241
ATGTGGACATCAAAACATATTTTTATTCATGATTATAAGCTAGTGGATGTATTTCTAAAGGAGAAACTTC
TACCATTAATTAATCAATGCGCTTTAGATAAGTGGTTTTTTATTCGGTATTGGCAAGGGGGACCACATAT
ACGTTTGAGGTATAAGATTAAGGAACTGCAAGTGAAACATGTTTTTGAAAAAGAATTAGAAGATACATTA
AGAGACTTTCAGTTGGAGTATCAGAACGAAAAATTCTCTGAAGTGTCTTATGATGATCGAGTTGTTCAAT
TAGAAGGGGTTAAGGATTTAAAAGTATATCCTAATTTTTCTATACAAGATATTTTATATGTTCCAGAAGT
AGCGAGGTATGGTGGAGAAGAGGCTGTTTCATTCTCAGAAGAATTATTCTCATATTCTTCTGAATTGGCG
AGTTATGTAATTCAGGAGATAGCTTGGCCTAAGAGGTATATTATAGCGTTTGATGTGATGTTTTATAGTT
ATAAAATGGCTGAAAAGCTTGGAATTGCTCCAGCAAGGGAAGTATTTTTTAGTAGCTATAATCAAGTTTG
GAGTTCTTTTAAAGATAGAGAAGAATTAAGTAAAATACAAAGTTTATTACAAACAAGATTAGAGCAGCTT
GAGAACAAAGAAAGTATTCCAAAGGTATATAATAATTATTTTGAGAGTATGGAGAATAATCTTAAATTAA
TTATGGAACATCAAAATATTTATACAAAAGAAACGATATATTACATTTTAATTTCTCACATTCATATGTT
GAATAATCGTCTAGGGTTATCACCACAAAATGAATACTTACTATCAAGAGTATTCTTGAAAAAAGGGGAT
TATTCAAATGAAGTTATGGGACTTTAA
 Primer design

Protein Sequence:288 a.a.
>BCE_G9241_0525|ThioFinder889 Bacillus cereus G9241
MWTSKHIFIHDYKLVDVFLKEKLLPLINQCALDKWFFIRYWQGGPHIRLRYKIKELQVKHVFEKELEDTL
RDFQLEYQNEKFSEVSYDDRVVQLEGVKDLKVYPNFSIQDILYVPEVARYGGEEAVSFSEELFSYSSELA
SYVIQEIAWPKRYIIAFDVMFYSYKMAEKLGIAPAREVFFSSYNQVWSSFKDREELSKIQSLLQTRLEQL
ENKESIPKVYNNYFESMENNLKLIMEHQNIYTKETIYYILISHIHMLNNRLGLSPQNEYLLSRVFLKKGD
YSNEVMGL