Home 

Gene Symbol:  
BCE_G9241_0519
Organism:  
Bacillus cereus G9241
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
34275..36779 [1], 2505 bp
Product Function:  
lanthionine biosynthesis protein, putative
Product Locus:  
 ZP_00237839.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2505 bp
>BCE_G9241_0519|ThioFinder883 Bacillus cereus G9241
TTGAAATATGAGATTTTAAAAAACCCAATAGTTCTTTATAGAGGAAGTGACGTTACAAAAGATTGGTACA
ATGAAATGATGGCAACATCAGCTTCATTAAAGGATGTATTACATGTCATAAAAAAAAATGAAGATCAATT
AGCAATAATTAAAGAAAGACTAATTGTTAAGATTGAAAATGAATTTGCTTTAGTAAAAGAGATGAGTTTA
TTAAATTTAAAAAGAGATATTCATAACATAAGGATAGGTCGTATAGAGAAATATATTAAAATATGTAAAA
ATACTGAATTGAAATCTATGCTTGGAGATTTTGTTGACCTATTAGCACAAAATGCAAAACTTACTGAAGA
ACTTGCTGAGGAATACACCCATGTATTGAAAGCTAATAGAGAAATTTTGCAAAAGAGTATAGATGATGAA
GAAGTTTTAAAATCTATCGTATTTTATAATAATGAGATTTATCAAAAAATTAAGAAATATACAAGTGAAG
AAGTTGAAAAACATAGTAAGAAATTAAAAAAATTAGATTATTTTCTTCTGAAAATGTTAGTTCGTTCTTC
AATGAAAACAAGTCCATTTTCTCATCTAACAAAAACAGGACTAGTTTCTAACACGGAAGGGATTGAATTC
GAAAAAACATCGTATAGTGAATTGAATCATGCGGTTATTTTACAAGCGATCCACCGTTATCTACGAAGTA
ATGAACAAGCATTACAACGTATTCCAGTGAAAGTAGAGAACTTTGGAAGCAAAGAACAAGGTATTTATTA
TGTGACACAAAATGATGTGGAACAATCAAAGAAAGTATTAGAGACAAGCGATAAGTTTGTTGAATACAAA
CTTGATAAAAACTTAATTCAATTTTTACATGAAAATAAACAGAAAGTAATTGGGTTTGAACAATTTAAAC
AAATAGCAAGAAAAATCACGATTTACCAAGGCAAAGAACTTCAATTATTTCGTAAGTTAGTCGAATTGAA
GTTATTACGACAGTGTATAACAATTCCAAATAATAGAGGGGTTATTACTTCTATCATTCAATTTTTAGAA
GAATATGAAGTAGGGAAAGAAATAATACCTTTATTAGAAGAGCTACATGCTGCATTACATTCTTTTGAGA
AAAGTAGTTCTTTTGAGCGGATCAATGATTGGAATGAAATAAAAAGAATTCTCTCATTACTACAAAAAGA
GGATAAAAAGATTGGTAGTGAGATTATATATGAAGATGTAATCTTTAAAGATGTTCGAAAAGATACCATT
ACACCTAAGATTCGTAAATCTTTTTTAGAGGGGCTAGCTGATTTCATCTTATTATTTGATGTCAATGTGC
GTGTTCAATATGAGATAGCTCAATTATTTTATGAGAAATATGGAAAAAGTACTGAAAAACTATCTAATAG
TAATTTGTTAAATGAAGTTTTCTTTCGTGAAATTCATCAATTTTATCCATATTATCAAAACCAGAAATAT
CGTTATAAAGAAGCGAAAGCAAAAGAAATTCAGCAGTTGGATGAACTTCGAGATCAATTTTTGAAAGAAT
TTGAATCGCTTATTTTAAACGTAGATCAATCAGTTGAAGTAATCGATATTGAACTGTTAATCGAAAAATA
TACGAGTCTTATTCCAGAATATATAAAAAAGGATAGCAATATTTCTTATACACTATTTTTGCAAGAAACA
ACTGATGAAAATATCGTGCTTAATAATGTATATGATGGCCAAGAAAAATTCATATCACGATTTAAAGATT
TTTTCATGCCGCATTATGAAACAAAGGAATATTCGAATTATATAGAGCGTGTATTTAATGAAGATAACTG
TTACGAGGTAGATGAATTATTTGGATTTAACGGTGGGATTCATAAAAGAAAATCTCATAATATCGTCAAT
TTAGATGTAGGTTATCAACGATTTAATCATAAGGATGCGAAGCAAGTAAGAGATTTTACAGTACGTTATA
ACACAGAAAAGAAAAAAATAGAATTTTTAGATGCTAATGACAAAATATGTAATTTAGCGTATAAATCATC
ACTTGTTCCAATGTTTTTACCTGGTATTTTATCTGTTATGTTGTATCTATTTCAATCAGGAAGATTAAAT
TTTGATATTACTTCGTTGGTAAAAGAAGAAAATTATGTGCCGCGAATTACGTTTGGTAATGTAGTTTTAT
CAAGGAAAAAATGGAAGGTAATAATGGAAGATCTAAAGGGCATTTTAGAATCAAAACTACAAGCACATGA
ATTATACGAGGAATTAAATAGGTATTTCAAGCAAAAACAATTACCAAAACAATTTTTCCTTAAACATTAT
CGTCAAAATGGAGATTTTATGGTAGAAAAACCAATCTTTTTTGATATTGAATCACCGGTCATAATGAAGT
TCTTTATACATGAGATCCAAAATGCGATTGAAAATTCAGGATCATTATATATAGAAGAAGTTTTGCCAGA
AATAAATGTCCCACTTAATGAATATTTAATTGAATATTCGTTCAAAAAGGAGTAG
 Primer design

Protein Sequence:834 a.a.
>BCE_G9241_0519|ThioFinder883 Bacillus cereus G9241
MKYEILKNPIVLYRGSDVTKDWYNEMMATSASLKDVLHVIKKNEDQLAIIKERLIVKIENEFALVKEMSL
LNLKRDIHNIRIGRIEKYIKICKNTELKSMLGDFVDLLAQNAKLTEELAEEYTHVLKANREILQKSIDDE
EVLKSIVFYNNEIYQKIKKYTSEEVEKHSKKLKKLDYFLLKMLVRSSMKTSPFSHLTKTGLVSNTEGIEF
EKTSYSELNHAVILQAIHRYLRSNEQALQRIPVKVENFGSKEQGIYYVTQNDVEQSKKVLETSDKFVEYK
LDKNLIQFLHENKQKVIGFEQFKQIARKITIYQGKELQLFRKLVELKLLRQCITIPNNRGVITSIIQFLE
EYEVGKEIIPLLEELHAALHSFEKSSSFERINDWNEIKRILSLLQKEDKKIGSEIIYEDVIFKDVRKDTI
TPKIRKSFLEGLADFILLFDVNVRVQYEIAQLFYEKYGKSTEKLSNSNLLNEVFFREIHQFYPYYQNQKY
RYKEAKAKEIQQLDELRDQFLKEFESLILNVDQSVEVIDIELLIEKYTSLIPEYIKKDSNISYTLFLQET
TDENIVLNNVYDGQEKFISRFKDFFMPHYETKEYSNYIERVFNEDNCYEVDELFGFNGGIHKRKSHNIVN
LDVGYQRFNHKDAKQVRDFTVRYNTEKKKIEFLDANDKICNLAYKSSLVPMFLPGILSVMLYLFQSGRLN
FDITSLVKEENYVPRITFGNVVLSRKKWKVIMEDLKGILESKLQAHELYEELNRYFKQKQLPKQFFLKHY
RQNGDFMVEKPIFFDIESPVIMKFFIHEIQNAIENSGSLYIEEVLPEINVPLNEYLIEYSFKKE