Home 

Gene Symbol:  
BCE_G9241_0523
Organism:  
Bacillus cereus G9241
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
39762..41486 [1], 1725 bp
Product Function:  
hypothetical protein cytosolic protein,putative
Product Locus:  
 ZP_00237843.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1725 bp
>BCE_G9241_0523|ThioFinder887 Bacillus cereus G9241
ATGAAAGTAAAATATATAACAGATTTAGCTAATTATCATGAAGTAGGAATTGGAGAAATATCAGTTTACT
TTAATAAACAATTTATATTTATTGGTCCTATTCGCACCTATAGTTCTGCTTGTTTTAATTGTTTTCAAGA
GCGAGTAAAAGAGCAGAAATTAAGTGAATATTATTTTTCTACTGCTAAGCATTTGGCACTTAATGATGTG
GAAGAAGAGATCGTCAAATCATATTTAGAAAAAATCGCAAATAAAGAAGAACAAGGCATTATTTATATTT
TTAATCGAATTACAAAAGAATGTGAATTAGTAAGCACATTTAAAAGAGGAGATTGTCTACACTGCTCATC
TGACGATATCAATTATGTAAAGAGGGATAGTAAGAAGGAAGGATATCCATTTGAAAAATTAAACCCTCGT
CAAGATAAATGGGAGAATGTAAAAAATCGATTACAGAAGTTTAAACCACTTCTTTATAAAAATAGGTTCT
CTTTAATTAATAGAATCAATAGATCTGGTGATTCTTATGGATTACCTATGGTAGAAACAGAGGTATATTA
TAAAAATGTTTCTATGCTATCTTATGGTAGAACAAGTACATATGAAAAATCGCGTTACACAGCTATTTTA
GAATCATTAGAACGTTATGCAACTGCTTTTCCATATAAAAGATCTCCTTACCATTTTCGAGAAAAGGAGA
ATGAAAATATTGATTTAAAGATTTCAGAAATTATTGAGTTAAATAATCTTGAGACAGGTGAATATAGTGC
GGATACTCCTATCTATTATACAGAGGTAGATGCTTTGCATAAGGGAAAGAAAGCATTAATCCCAGAGCAA
ATTGTGTATTTTGATTCACATCATTCTTCGGATGAGAAGCGATATATTTTTGAAAGCTCAAATGGAAGTG
CATTAGGGTCTACTCTTGAAGAGGCAAGTTTATTTGCAATGTTGGAATTGTTTGAACGTGATTCTTTCTT
ATGTACATGGTATGGAAAAATCCCACCAATCCGCATTGAAACAGAGTCGTTAAAATCATCAAAGATTCAA
AACTACATAGTAGCTTTGCAAAAGAAAGGTATTAAAGTTCATGTTTTTGATATTTCTATAGAATTAAAAA
TTCCTACAATATGGGTATTACTTGAAAAGCAAGATCCTAAAGAAAGTGACATGGCGTTTTATACAGCTGC
AGCTACATCGTTTGATTTAGAAGATGCTATTGAAAAAGCATTAATTGAAGCAACAACTGCCATTTCTGTA
TTTACTAATTTATTCCGAGGAGAAGATTTTCAACAGAGAAAAAGAATGCTTTTAAAGGATCCAACAAAGG
TAAGTAGACTTGAAGATCATTTATTACTGTATTCTAATCAAGAAATGAGATCATATTTAGAATTTGCACT
TAATACGCCATATCATATAACAGATGATGAATTAGAAAAATATTATTTGGAATTTGACGGGAAATATACG
GAAGTATTAGAGTATTTCCATAGGAAAATATTAGAAATTTCAGACAAGGCATACCGAGCAGCTACAGAAA
ATATGAATTTAAATGAATTAGGGTTTGTTAATGTGAAATATGTTGTCCCTAAAATGTTAACAATGACATT
TGGGCATCAAAATAGAAGAATTGTGAAATCAAGAGTGGAAAAAGCAATAGCGTATAAGGGAAGAGGATAT
GTGGATACAGAGTGGATGGAAAAAATCCCACATCCATTTCCATAA
 Primer design

Protein Sequence:574 a.a.
>BCE_G9241_0523|ThioFinder887 Bacillus cereus G9241
MKVKYITDLANYHEVGIGEISVYFNKQFIFIGPIRTYSSACFNCFQERVKEQKLSEYYFSTAKHLALNDV
EEEIVKSYLEKIANKEEQGIIYIFNRITKECELVSTFKRGDCLHCSSDDINYVKRDSKKEGYPFEKLNPR
QDKWENVKNRLQKFKPLLYKNRFSLINRINRSGDSYGLPMVETEVYYKNVSMLSYGRTSTYEKSRYTAIL
ESLERYATAFPYKRSPYHFREKENENIDLKISEIIELNNLETGEYSADTPIYYTEVDALHKGKKALIPEQ
IVYFDSHHSSDEKRYIFESSNGSALGSTLEEASLFAMLELFERDSFLCTWYGKIPPIRIETESLKSSKIQ
NYIVALQKKGIKVHVFDISIELKIPTIWVLLEKQDPKESDMAFYTAAATSFDLEDAIEKALIEATTAISV
FTNLFRGEDFQQRKRMLLKDPTKVSRLEDHLLLYSNQEMRSYLEFALNTPYHITDDELEKYYLEFDGKYT
EVLEYFHRKILEISDKAYRAATENMNLNELGFVNVKYVVPKMLTMTFGHQNRRIVKSRVEKAIAYKGRGY
VDTEWMEKIPHPFP