Home 

Gene Symbol:  
BCE_G9241_0518
Organism:  
Bacillus cereus G9241
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
33266..34285 [1], 1020 bp
Product Function:  
hypothetical protein protein
Product Locus:  
 ZP_00237838.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1020 bp
>BCE_G9241_0518|ThioFinder882 Bacillus cereus G9241
ATGAAAGATATAAGAATATATAATTACAAAAAATCAAAAGATCATTATATTATTCGTTTATTAAGAGAAT
ATACTAAAGGCATAGGAGCATATTATATTGCTCGCTCGTGGGAACATGGTCCACATATAGTTGTAACTTT
TAGTGAAACGGTGCCTTTGGAAGAGATACTTGTATTGAAAAATAATATACAACAACAAATAGATCAAATT
TCAATAGACCCAGAGCAATATGAAGAGATAAAGAGCAAATATCAGAAAAGTCTAGAGACCATCGCTTTGT
TAGAAAAAAAAGAAGCGAGTAACGTTTTAAAAGAACATGGTACTGTCGAAATTCAAGAAAATAAGTTTGT
ATACTACAATCAAGAACTAACTAATGTAATACATCAAGCGCGTATTCAGTTACAACCTATTTTAGAAGAG
ACATACTTATATCTATATGAAAATGAAATAAAACCTGAAGTAATGTATCCAGCTTTATTTCATGCTGTTT
CAGAATGTTACAAAGTAGATGGTACAAATAAAGGGTATTTCTCTTTTATATCTCATGTTCAAGGATTTTT
AGAGCTCTCTAAAAATCAATCATTAAAATATACAGAGAGTGGATTTGAAATGTTTTTTGAAAAAAACATT
TCTGAAGTTCAAACATTTGCTAACGAGCATCAAGATTTTATTGCTAGATGGCAACGAGAGTGGCAACTAA
TATTTGAAAGTTATGCAGACAGAATTATTGAAAATATTGATAAGCAATATCTTAAGGATCTAGAAACAAC
ATTTTCGGAATTAGAAGGGAAATTTAAAAATGATTTTCATAGCAAGTTTGCTATGTATGCTAAGAATACA
AATTTTGCTTCAAACCAAAATGCGACAGTATATCGATTCTTAATTAATATTCTCTATCTTTCGTTTCCCT
TTTTGAAAATCAGCGCATTAAAGAAACAATTATTTATTTATATGGCTTATCGATTTACAGAAACAACCTA
TAACATAAATTGGAGAAAGGAGATTTCTCTTGAAATATGA
 Primer design

Protein Sequence:339 a.a.
>BCE_G9241_0518|ThioFinder882 Bacillus cereus G9241
MKDIRIYNYKKSKDHYIIRLLREYTKGIGAYYIARSWEHGPHIVVTFSETVPLEEILVLKNNIQQQIDQI
SIDPEQYEEIKSKYQKSLETIALLEKKEASNVLKEHGTVEIQENKFVYYNQELTNVIHQARIQLQPILEE
TYLYLYENEIKPEVMYPALFHAVSECYKVDGTNKGYFSFISHVQGFLELSKNQSLKYTESGFEMFFEKNI
SEVQTFANEHQDFIARWQREWQLIFESYADRIIENIDKQYLKDLETTFSELEGKFKNDFHSKFAMYAKNT
NFASNQNATVYRFLINILYLSFPFLKISALKKQLFIYMAYRFTETTYNINWRKEISLEI