Home 

Gene Symbol:  
HMPREF1034_2449
Organism:  
Propionibacterium acnes SK187
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3340..4293 [1], 954 bp
Product Function:  
thiopeptide-type bacteriocin biosynthesis domain protein
Product Locus:  
 ZP_06427460.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:954 bp
>HMPREF1034_2449|ThioFinder965 Propionibacterium acnes SK187
TTGAACTGTGTGCCGAGTGACAGCGCAAGCATGTCTGATCCTGGCGGCTGGCGGGCGCTCCATATTCACT
TGCCTCCCTCGGTGCAGTCCGAGTACCTAGCTGACGTGATTCTTCCCTCGATGTCAGCCTTGATGCCAGA
ACATGACTACTTCTTCCTCCGATATTGGCAGGGGGGATCACATCTCCGGCTTCGGCTCCGTAGCACTCCC
GAGCGCCCCCTAGATGATGAGGCTATCAACGAGGTTGCATGCCATCTCCGTAGCCTTCTCCCGGCGTTGT
CAGACCAAAAGCGCGCGGAGTACCGCTATTCGCAATCGCTTCAGGATCAGTTAGCCGAAATGGAAAGGGC
TGATTGCCTTCCCCTAGAGGCGGTTGGGACCGTGGTAGAGCGCCGGTACCAGCCTGAATATAGAAAGTAT
GGCGGATCGGTCGGAGTATCCATTGCAGAGGATGTTTTCTGTAGTACTAGCCGATCTGTCCTTCGCATTC
TGAGTGAGCGACCAACTAGCCACCGACAGCCCTTGGGGTACGCTTGCCAGGTTTTCATCCAGATGCTGGG
CTGCTTAGGGCTCGCAACTTCGCAGGTTGACCAGTTCCTCACCAGATATGCGCAGTGGTGGACCCCTTAC
TCAATGGCCGCTCGCCCTGAGATCTTAGCGGCGCGTCTCTACGCCAACTTGTCAAGCGTGGTGGCGGACC
TATGGGCCGCAAGTGAGCCCAACGGAATGTTCTCGGTTCCGGCTCTCAATGCTTATACCCAATGGTCACG
GCGACGGTCGTCCGCGAGAAATACCAGCGTAAAGATAGACCCAATGTTTCTATCTTGCTTAGCGAACTAC
ATTCACACAACCAATAACCGACTTGGGCTCCCACCCGCCCTAGAATCGACAGCGGCATATCTTGTCCAAC
TTGGATTCCGATCGGTGGCTGTCAGGGGGGAGAAAGTGCGATGA
 Primer design

Protein Sequence:317 a.a.
>HMPREF1034_2449|ThioFinder965 Propionibacterium acnes SK187
MNCVPSDSASMSDPGGWRALHIHLPPSVQSEYLADVILPSMSALMPEHDYFFLRYWQGGSHLRLRLRSTP
ERPLDDEAINEVACHLRSLLPALSDQKRAEYRYSQSLQDQLAEMERADCLPLEAVGTVVERRYQPEYRKY
GGSVGVSIAEDVFCSTSRSVLRILSERPTSHRQPLGYACQVFIQMLGCLGLATSQVDQFLTRYAQWWTPY
SMAARPEILAARLYANLSSVVADLWAASEPNGMFSVPALNAYTQWSRRRSSARNTSVKIDPMFLSCLANY
IHTTNNRLGLPPALESTAAYLVQLGFRSVAVRGEKVR