Home 

Gene Symbol:  
HMPREF1034_2452
Organism:  
Propionibacterium acnes SK187
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7309..8904 [1], 1596 bp
Product Function:  
bacteriocin biosynthesis cyclodehydratase domain protein
Product Locus:  
 ZP_06427466.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1596 bp
>HMPREF1034_2452|ThioFinder968 Propionibacterium acnes SK187
ATGAAGGGTATAATCAGTGGTGAACAGGTGGGAAATGCAGCTCGCTTTGACAAGCAGTTCAGGGTCCCTC
GTCGGCCGAGCAGGCGGCTCGGTGTCGATATTGAGATCCGTGAGGACGCAACAATTCTTTGGGGATCAGA
TCGTCTGCAGACATTTACAGGAGGAATGAAACCTTCACTGATTGAGGATATTTTACGAGCGTGCGACGGA
ACTAAGACGGCACGTGAGCTCGCCTCTGTATGTGATGTTACGGAGCCCTTGATGGACAAGATAGTGGCCC
TTCTCTGGGTCTCGGGTGCTATTGAGGAGGCGGGCCCGACCGATGTTGAAAGTTCTCCGCTTGGGGTCCT
TTTGTCTCGCCTTGGGAACGCAACTGGGGCGAATGCTAGCTGGCAGGAAGCTCAGCACAGAATTAACAGC
ATGCCGATCTGTGTTATGCCCCATTCGGAACTTGGAACGGAGGTTGCGGGCGCGCTTGCTGGCACCTTTG
AGGTTATCAATGAAGAGGCAGCTTTTGAACGCGGCGTGGTTCTATTCATCTTTATCGAAACCGCGTCGTC
TAAGATCGAACAGCATCACAAATTTGATGAACTGACAAAGAGAAGAGTGCTATTGGTTAGCGCTGCGGGT
GACGAAGTTGTAGTGGGGCCGCTTTATGACCAGGCTATAACGCCCTGCCTTCGGTGCTGTTCGTCATCGA
GGATCAAGCTGGATCGGGGTGCCTCGAGCCCGGCGCAGCTTCGTCTCATGGCTGGAATTGTCTCGCATCA
TATTGTTGCGTTGGTAAGCAGGGCGTTACTCTCACCGCTGCCCACGGATTCCTTGGCGCTGAATGTGGTC
ACTGGTGTCCAGCGCTACTCTTTCCCGGTGTCCAGACCGGGTTGCCCCGAATGTTCGCATGCGATCCCAG
CTATTGCTAGTGAGCCGACGGTCGGTGCCGTGTACGAGGCTTCCGTAGCACTCCCTCCGCGAGAATTCGT
GAATGTAAGGGACTATCAAGCCCACTTCTTGAGCGCAAATCAACAACTTCAAACGAAATTTAAGTCATGG
GGAAAAAGGGAAAAATTCCCTTTGCCTGACATTAATATTTCAGACCTACATATACAGATTGACGACCTTC
TTTTTTTAGCTGCTGCCCTTAGGTTTGGGTTCGGAATAGACCCGGAGCGGACCACTTCAAAAATAGCGAA
GCGCTGGACGGCCTCTGGTGGAAACATTGGCTCGGTAAACGCATTCGTGAGCCTTCCTGCGATGGTAGGG
CACATTCCCAGTGGGATTTATGGATATTCAGTTAGCGATCATTCCCTAGCCAAAGTTAGTCAGGAGTTGA
TTTCGGCGACTGACATCATGATTGCGGCTTCTGCCGACCTACGGAAGATCGCTTCTAAATATGGGACATT
CGGCTTGAGGATCGCGATTATGGACGCCGGGTGTGCCCTTTCAACGGTGCGTCGTGTCTGCCGGGAAGTA
GGCCGTACATTTTCGATGTGGAGCGCTGACCTCGACGCTGGGTCTATTAGCGAGATGCTGCATCTTTCAA
GTGCGCGTGAGCCTATTATTGGAGTTTCAGTGCTGGGAAAGGGGCAACGAGGGTGA
 Primer design

Protein Sequence:531 a.a.
>HMPREF1034_2452|ThioFinder968 Propionibacterium acnes SK187
MKGIISGEQVGNAARFDKQFRVPRRPSRRLGVDIEIREDATILWGSDRLQTFTGGMKPSLIEDILRACDG
TKTARELASVCDVTEPLMDKIVALLWVSGAIEEAGPTDVESSPLGVLLSRLGNATGANASWQEAQHRINS
MPICVMPHSELGTEVAGALAGTFEVINEEAAFERGVVLFIFIETASSKIEQHHKFDELTKRRVLLVSAAG
DEVVVGPLYDQAITPCLRCCSSSRIKLDRGASSPAQLRLMAGIVSHHIVALVSRALLSPLPTDSLALNVV
TGVQRYSFPVSRPGCPECSHAIPAIASEPTVGAVYEASVALPPREFVNVRDYQAHFLSANQQLQTKFKSW
GKREKFPLPDINISDLHIQIDDLLFLAAALRFGFGIDPERTTSKIAKRWTASGGNIGSVNAFVSLPAMVG
HIPSGIYGYSVSDHSLAKVSQELISATDIMIAASADLRKIASKYGTFGLRIAIMDAGCALSTVRRVCREV
GRTFSMWSADLDAGSISEMLHLSSAREPIIGVSVLGKGQRG