Home 

Gene Symbol:  
HMPREF1034_2451
Organism:  
Propionibacterium acnes SK187
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5372..6691 [1], 1320 bp
Product Function:  
YcaO-like protein
Product Locus:  
 ZP_06427463.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1320 bp
>HMPREF1034_2451|ThioFinder967 Propionibacterium acnes SK187
ATGACAGTTGAGCGTCAGCCTCTGCGGGAGCGTGCAAGGAGCCTCGTTTCACCATACGGACTAGTTTCCC
AAGTACACCCTCTGCACGCCAATGAAGCAGATCCACCGTTTCATGTGCATTTGGGTCGAACAGGCCACTC
AATACACGAGGGGCAAATTACTTTTGAGGGAGATATCGGAAACACCGACGGGGCAGGGTCGGGATCCGAC
AGTACCACGGCAGAATTTATTGCAGTAATGGAGTCCTTAGAGCGCTACTCCAGCGCAATGTGGGACGCTC
GTTCCTTTTTGCTGGAATCGGAAAATAATCTGCAGGAGCGACTTGTATCTCCCAACCAATTCCCACGCTG
TTCTACAGCCGAGCTAGATTCTGGACATGTACTCAGGCGGTACGACCCGGGCGTCCCAATACGATGGGTC
AGAGGATGGTCACTGACTTCAGGTCATCAGGTGTGGGTTCCGGCGATCGCGGTTTATCTGCATCTGCCGT
ACTTAAACGACTCTGAACGATTCATACGTTCAGTCTCGACCGGATGTGCGGTTCATGAATCCATGCGGAA
GGCTGTTCTTAACGGTCTTTTAGAAGTCGTCGAGCGAGATGCTATTGCTTTGACTTGGTTGCATGAGTTG
CCCTTGCCCAGAATCGCGGCTAGCGAGGCCGGTGAGTTCCCGCCGGAAGCGCTAGCCAGTTGGAAGTCAT
ATAGGGATTACGGAATCGAGACCCATCTCTTTGACGCAACGACGGATTTTGGGATTCCGGTGATCTTTGC
GCTCCAGATATCGGATCAGGATGACGACATCGCTCAGCTCGTAGGAGCTGCATCCGCTTTGGAACCCGCT
GAGGCGCTGACTAAAGTATTCAGGGAAATGGCATCGATCCGAATAGCACTACGCGCCTTTCTCGCCCAGT
CCACATCGATTAAGATTTACCCCGATGTGGCTAACGTGACAGGGGGTGCCGCCCTCATGGGCCAGCGCGC
GTACCGAGATGCATTTTCCTTCCTCCTTAACAGCGAGCGCGAAACGTCACCGTCGCGGATGCCTAACCTC
CTAGAGCTGAATGATGATCCACTGCGCGAGATGATTATTCGAATACGCCTGGCTGGCGCTGAAGTTATCG
CCGTCGATATCACGACGGACGAAGCGAGGTCAGTTGGTGCAAGAGTAGTGAAGGTTTTGGTCCCAGAGGC
GGTTCCACTCTCCTTTGTTCACCGAGAGAGGTATTTAGATACTCCTCGGCTCATATCCGCGCCTAATAGC
ATGGGATATTTGGTTGACACAGCGCCTACGTTCAACCGGAACATTCAACCTTTTGCGTGA
 Primer design

Protein Sequence:439 a.a.
>HMPREF1034_2451|ThioFinder967 Propionibacterium acnes SK187
MTVERQPLRERARSLVSPYGLVSQVHPLHANEADPPFHVHLGRTGHSIHEGQITFEGDIGNTDGAGSGSD
STTAEFIAVMESLERYSSAMWDARSFLLESENNLQERLVSPNQFPRCSTAELDSGHVLRRYDPGVPIRWV
RGWSLTSGHQVWVPAIAVYLHLPYLNDSERFIRSVSTGCAVHESMRKAVLNGLLEVVERDAIALTWLHEL
PLPRIAASEAGEFPPEALASWKSYRDYGIETHLFDATTDFGIPVIFALQISDQDDDIAQLVGAASALEPA
EALTKVFREMASIRIALRAFLAQSTSIKIYPDVANVTGGAALMGQRAYRDAFSFLLNSERETSPSRMPNL
LELNDDPLREMIIRIRLAGAEVIAVDITTDEARSVGARVVKVLVPEAVPLSFVHRERYLDTPRLISAPNS
MGYLVDTAPTFNRNIQPFA