Home 

Gene Symbol:  
HMPREF1034_2450
Organism:  
Propionibacterium acnes SK187
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4290..5372 [1], 1083 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_06427464.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1083 bp
>HMPREF1034_2450|ThioFinder966 Propionibacterium acnes SK187
ATGAATCCAAAAAACTCCAAAGTGACGGAACTTTGGTTTCCAGATAATTCAGACTCGCCATGTACTCTTC
TTCTCGACTTATCTCGGGCCTCCGCTGAGGGCACTGAGCCTAGTCCTCAATACTACTGTCGAACTTGGGA
CCCAACAACAAAAGATCCCGGAGTAAGGGTTGGCATACTTGATCCCAACCGCTTAACTCATCAAACGGCT
TTCCTTGGCGGTTCCGGTATTACGCATCACTTCTTGGTAATGGAAAAACCACCCAGCTGGCCTCTTCTAT
GGAACGCGGGTTTCGCGGGCTTGAAGCTTTCCACGATAAGCAAACAATTGTTCACCGCGTCATATCCATG
GATGGTAAAGTGGGCGCTACAGGCATCGGCTTGGACGGACGACGAACGCCTTCTGGCTCTTACGAAACTT
CTAGTTGCCCACGCTGATGCAAGCCTTCCACCGGTCGATAAGACTGAAATGCTCGGCCGCCTCCCTTTGA
AGTTGAGCTTGCGACTGATCACATATCGTTCCCACTACGAAAGCATCCGCGCTCGCACGATTGACCCGAA
AGCGATGGATACTGCGGTTAATCGGGCCTTCATGAAGTATCAAGACGAGCTCCTGCGATGGTCCCAGTCG
TTGACATGCTCGTCGAGCTATCGTGAGAAAGAATGGAGTAATCCCAACCTTTCAGAATGGAGCGCCATCA
TTTATTGCCATCTCCCACAAATTAGGCAACTCCTCAGCGGGGGAGGATTAACTGTCGCGGGCCCGACACG
CGAGGATATAGAAGCCTCCTTAGGTCACAGTATTCCTGATACACGATTTCACGAGCGTCTTGACCCCGCC
ATGCAGTATTATCTCAATCATGACCAAGACTTCACGGCATACAGATTCTGCACGGGTTTTTTGTACAGCA
ACCTGTACTCGCTAGGAATACCGTTGAGGCTGCGCTACCTTGTCTGTGGGTTGGCAGCACGTTTCAACGA
GGAGCTGTCGGACACGACTTGGCGCGATTTACGGGATCTCTTCCACGAGGCTGCTACTGTTGCATATTAC
ACACGCGACACAGACGGGAGCGGGATTAGATAA
 Primer design

Protein Sequence:360 a.a.
>HMPREF1034_2450|ThioFinder966 Propionibacterium acnes SK187
MNPKNSKVTELWFPDNSDSPCTLLLDLSRASAEGTEPSPQYYCRTWDPTTKDPGVRVGILDPNRLTHQTA
FLGGSGITHHFLVMEKPPSWPLLWNAGFAGLKLSTISKQLFTASYPWMVKWALQASAWTDDERLLALTKL
LVAHADASLPPVDKTEMLGRLPLKLSLRLITYRSHYESIRARTIDPKAMDTAVNRAFMKYQDELLRWSQS
LTCSSSYREKEWSNPNLSEWSAIIYCHLPQIRQLLSGGGLTVAGPTREDIEASLGHSIPDTRFHERLDPA
MQYYLNHDQDFTAYRFCTGFLYSNLYSLGIPLRLRYLVCGLAARFNEELSDTTWRDLRDLFHEAATVAYY
TRDTDGSGIR