Home 

Gene Symbol:  
HMPREF9056_02782
Organism:  
Actinomyces sp. oral taxon 170 str. F0386
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
33508..34692 [1], 1185 bp
Product Function:  
thiopeptide-type bacteriocin biosynthesis domain protein
Product Locus:  
 ZP_08294864.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1185 bp
>HMPREF9056_02782|ThioFinder988 Actinomyces sp. oral taxon 170 str. F0386
ATGAGCACGCACGACGACGCCCGGTCCAGCCGGCGCGAGCAGCGCAACCAGCCCAGCCGGCTCACCCGCT
CCCGGCGGCTGCGCTGGCTCGGCGGGCGATCCCGGGTCGGAGAGCAGGCCGAGCCGTCGGGACAGGCCGG
CCAGCAGAGCAGTCGGGGCAGCCAGGGCGGTCAGGGCGACGCGGCCCCGCAGGTGGGGGCCTCGATCCCT
GGGATCCAGCCCCTGGAGATGGCGGCCGCCGACTTCGGCAGCCTGCGCGCCCAGCACAGCTCGGTGCGTC
AGCGGGGCTCGGCGCTGGTCAATCAGGCCGAGGACGTCGGCTGGTTGTACGCGCGGATCTACTGCGCCGG
CGGGGACGACACCGACGAGCTGCTGCCTGAGATCGCCCAGTGGCTGGCCCGGGCTCGCGGCCAGTGGGAC
ATCCGCTCGGCGCACTTCCTGCGCTTCGTGGACCTGCGCGGGCACCACATTCGGCTGCGGCTCAAGGCCG
TCCAGGGCGTCCTGGACGAGGCCTACGCGAGCATGCGCGAGCTGGGGGCCGTCGCCCGACGGACCGAGGT
GAGCACGGTCGAGCGCCTGGTCTTCGACCCCATGACCGGAGGCATCGGCGCCAGCCGGCCGGGGATCGCC
TTCGGTGTCTACGGCCCCGAGTACGACAAGTACGGGGGCGTGGCCGGCGTCGAGGAAGCCGAGCGCCACT
TCTACGTCTCCAGCCGGTGGTGCCTGGACCACCGGATCTGGCAGATTCCGCGTTCGGTGCCGCGAGCGGC
CCTGGCGGCGCGGTTCCTGGCGCTGGCGGCCCGCAGCGCGCCACTGCCCGAGGCCGAGCTGCTCTCCGCG
CACCTGCGGATGTGGGGCTCGCGCCTGCCCGCGCACCTGCGCGACGGCAGCGCCCTGGGACCGATCGTCC
AGCAGCTGCTGGAGGTCATCGAGTTCCAGTTCGACGAGATCCCCTCCTGGGGCCAGGCGGCCGGGGCCAT
TGGCGAGCTGGCCGACGACGCCGGGCGCGCCATCGGCGTCATGGGGGCGGGAACCGGTGGGCGCCGTGCC
CTGGACCTGCTGCACATCGACGTCAACCGGCTCGGGCTCAACCCGGCCGAGGAGTGTATCGCCGGGCTGT
GCGCCCGCCAGCTCCTGGCCGGAGGCGCTGTGCCCCCGGCCCAGCCCTCCGCCGCCGCCGGATAG
 Primer design

Protein Sequence:394 a.a.
>HMPREF9056_02782|ThioFinder988 Actinomyces sp. oral taxon 170 str. F0386
MSTHDDARSSRREQRNQPSRLTRSRRLRWLGGRSRVGEQAEPSGQAGQQSSRGSQGGQGDAAPQVGASIP
GIQPLEMAAADFGSLRAQHSSVRQRGSALVNQAEDVGWLYARIYCAGGDDTDELLPEIAQWLARARGQWD
IRSAHFLRFVDLRGHHIRLRLKAVQGVLDEAYASMRELGAVARRTEVSTVERLVFDPMTGGIGASRPGIA
FGVYGPEYDKYGGVAGVEEAERHFYVSSRWCLDHRIWQIPRSVPRAALAARFLALAARSAPLPEAELLSA
HLRMWGSRLPAHLRDGSALGPIVQQLLEVIEFQFDEIPSWGQAAGAIGELADDAGRAIGVMGAGTGGRRA
LDLLHIDVNRLGLNPAEECIAGLCARQLLAGGAVPPAQPSAAAG