Home 

Gene Symbol:  
HMPREF9056_02781
Organism:  
Actinomyces sp. oral taxon 170 str. F0386
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
31001..33511 [1], 2511 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_08294863.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2511 bp
>HMPREF9056_02781|ThioFinder987 Actinomyces sp. oral taxon 170 str. F0386
GTGGCGGCACCGGATCCGGAGCCCCCGGCCCTGGCCCAGCCCGCCGTTGCCCTGCCCACCCTCGTGCGTC
TGGGCGGGCTCCCCGTGCGGGCCGTTCCCGAGACCACCGCCGCCGTCACCGGCAACCTGGAGTACTTGCG
CCGGCTCGATGAGGTTCTCGACGGCGCCGCGAACCAGCTGCTCGACCCGCTCTACGAGCTCATCCCCACC
CTGGCCAAGACCGAGCGCCGCCTGGTCCTGCGCGCCAAGCGCCGAGTCTTCCAGGGGCGCGCCACCGGCT
TGTCCGACGAGGTGCTCCAGGGCCTGCCGGCTGAGCTTCGCGCTCTCCTGGAGCGCTGGGACGCCCTGGT
AGCCCGCAAGGAGGAGACCCGCGCGCGCCTGGCCGTCCTCGTCGACGTCGACCTGGACCGCAGCCGCGAG
CTGCTGGCGGCCGGCCTTGACGAGCCCGGCTATCAGGAGTCCCTGGCGATCGCCGCCCCGGCCCTCATCT
CCACCCTGACCACCCGCGGCCGCAGGCTCGAGGACCCCCGCGTCCTGCGCACCCTCTACACCCTGGCCAC
CCGAGCCGCCCTCAAGACCAGCCCCTTCTCGGGACTGACCACCGTCAACGAGGCGGGTCAGCCCGCTGCC
GGGCGCAGCTACCGGATGGTGGCGACCCATCTGGCCTACCGCATCCTGAGCGTCACCGCCCAGGAACTGG
CTCCCGACGGCGCCCTCTACCTCGAGCCCGCCCCTGTGCGCCGGGCCTACAGCTCCAGCGCGGGCTCGGC
CGGTGCCTACGGCCAGTACCCGCCAGGTGAGGCCGAGGCGGAGGCACTGACAGTCGTCGGCGAGCACGAG
TACGGCAACGGCATGGTCTTCCGCCAGGAGACCGTTCAGCCCGCCCGCTGGCTCCAGGAGACCCATGACG
CCCTGACCGGCGGCGGCATGCACGCCGTGCTCAGCGTGCGCGACGCCTGCGAGCGGGTGGGTGGCGCCGA
CCCGCGCCTGCGCCTGGAGCGGCAGCTGGCCTCGGGCGCCGTCGTGCCGCGCGTGCCCTGGTACCGCGGG
GAGAACCCCTTCCCGCTGCTGGCCGCCACGCTCTCACCGGACCAACAGCACCGGTGGGGCCGGGACCTGG
CCTGGCTGGCCCGGCTCGATGAGGCCGTCGGCGCTGCCGACGGGCCCACGCGGGCCGATCTCCTCAACCG
CACGGTGCGCTTGGCCGAGCGCGTCTTCCCCGACGGCGAGCTCGGCGAGCGCCCCAGCGGCTTCCTCTAC
GAGGACCGTGAGTCGGCCCGCAGCTGGGCCGATCCCCTCGATGACGCCCCCTTCGCTCAGGACGTGCAGA
TCCTGGGCGAGCTCGCCGACCCCTGGGTGGCCCGCTCCCACATCTACGACCTCATGGTGGCCCGGTTCGT
CTCACTGTTCGGAAGTGGTGGGGTGTGCAAGGACCCCCTCGCCTTCTTCATGACCATCGCCCACGCCCCC
GACGGTGACGAGGAGATGCTGCGCGCCGCCGGACTCGACTACGCCGCCGGCCCCGACACGGAGCGCGCCG
CCATGCCCGGCGGGCTCTCCGGCTCGCCCAGGCACCTGGGCGCCTTCCTCCAGCCGGTGGCCCCCAGCGC
CCGGACCTACGCCGCCGGTGGGGGGCTCACCGTCGTCAACGCCTTCACCAATGCCAACGGCTCTCTCCAG
GCCCGCTTCCACCGGCTCCTGGGCTCCGGCTTCCGGGAGCGCCTGGCCTCGCGGATCCGTACCGCCTGGG
GCACCGAGCGGGTCCTGGAGATTCAGGCCAGCACCGAGTGCAATACCGGCCAGGCCGTCTCCTGCGGGCT
CCTGCCGCCGCTGGGCCTGCCCGACGAACCGGGGGCACCGGACGCGGTCCCTCTCAGTTCCCTGCGGCTC
GTCCACGACCCGGCCACGAGCACCCTGTTCCTGGCCGACGACGCCGGCCCCGTGGGATTGGCCTATCTGG
GCCTGACCCCCCAGTACCTCCTGGGCGGCTACCTGTCCTGGCTGGTGCTGCTGAGCGACCCGTGGTCCCG
GCTGCCCCCGTTCGCGGACCACTGGACCAGCCGCCGTCGGGACCTGAACGGGCCCCTGCCCGACGAGGTG
CTGCACTCCGAGCGCGCCGTGGCCGGCCGGCTGGTGACGCGCCGCGAGTCCTGGACCTTCCCGGCCGCGC
AGATCGCCCCACTCATGGATCGCGACCTGACCACGACCCTGCTGCACATGGACGACCTGCGCAAGCAGTG
GGGGATGCCGGTGGAGGTATTCGTCCACCAGCACATGCCCTCCCAGGGCGCCACCTTCGACCAGCACAAG
CCGCGCTACGTGGACCTCACCTCACCGGTCTCGCTGCTGGCGCTGCGGGGCTGGATCGATCCCAACGCCG
CCCACATCAGCTTTGTCGAGGCCCTCCCGGCCCGCGGCGAGGCCCTGGGGCTCACGCAGGACGGTGAGGC
GACGGTGGCCGAGTACTTGGTGGGACTCCAGTGGTCCAAGAACCTGGAAGGCATGGCATGA
 Primer design

Protein Sequence:836 a.a.
>HMPREF9056_02781|ThioFinder987 Actinomyces sp. oral taxon 170 str. F0386
MAAPDPEPPALAQPAVALPTLVRLGGLPVRAVPETTAAVTGNLEYLRRLDEVLDGAANQLLDPLYELIPT
LAKTERRLVLRAKRRVFQGRATGLSDEVLQGLPAELRALLERWDALVARKEETRARLAVLVDVDLDRSRE
LLAAGLDEPGYQESLAIAAPALISTLTTRGRRLEDPRVLRTLYTLATRAALKTSPFSGLTTVNEAGQPAA
GRSYRMVATHLAYRILSVTAQELAPDGALYLEPAPVRRAYSSSAGSAGAYGQYPPGEAEAEALTVVGEHE
YGNGMVFRQETVQPARWLQETHDALTGGGMHAVLSVRDACERVGGADPRLRLERQLASGAVVPRVPWYRG
ENPFPLLAATLSPDQQHRWGRDLAWLARLDEAVGAADGPTRADLLNRTVRLAERVFPDGELGERPSGFLY
EDRESARSWADPLDDAPFAQDVQILGELADPWVARSHIYDLMVARFVSLFGSGGVCKDPLAFFMTIAHAP
DGDEEMLRAAGLDYAAGPDTERAAMPGGLSGSPRHLGAFLQPVAPSARTYAAGGGLTVVNAFTNANGSLQ
ARFHRLLGSGFRERLASRIRTAWGTERVLEIQASTECNTGQAVSCGLLPPLGLPDEPGAPDAVPLSSLRL
VHDPATSTLFLADDAGPVGLAYLGLTPQYLLGGYLSWLVLLSDPWSRLPPFADHWTSRRRDLNGPLPDEV
LHSERAVAGRLVTRRESWTFPAAQIAPLMDRDLTTTLLHMDDLRKQWGMPVEVFVHQHMPSQGATFDQHK
PRYVDLTSPVSLLALRGWIDPNAAHISFVEALPARGEALGLTQDGEATVAEYLVGLQWSKNLEGMA