Home 

Gene Symbol:  
HMPREF9056_02778
Organism:  
Actinomyces sp. oral taxon 170 str. F0386
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
28453..29193 [1], 741 bp
Product Function:  
conserved domain protein
Product Locus:  
 ZP_08294860.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:741 bp
>HMPREF9056_02778|ThioFinder984 Actinomyces sp. oral taxon 170 str. F0386
GTGCGCACTGACTTCGAGACGTTGCGAGAGCTCGTCGCCGGCTTCTCCTCCGGATCGGGACGCCGCCCGG
GCGAGGAGCCCACCTCCGACGGCCTGGCCGGGAGCCGCCCGCGCCCGCCGCTGGACTGCCGGGCGCCGGA
CGTACTCGTCCCCGGCCCCCAGGGCGCCTACCCCTACGACCTGCACCAGACCTTCGAGCGCCGCTCGTCG
TCGACCAGCTATGGCGCCGAGCCGCTTGAGGCCGAGCCCCTCCTGACCATGGTCCGCGACGCCCTGGCCG
ATGACGTGCGCACCTGGGGTGAGGACGCGCAGGCTTGCCCCCTGGAGCCCTTCATCCTCCTCCTGCGCCC
GAGCGGTGCCGAGCCGGGCATCTACCGGGTGCGGCTCGACGGCGTCGACCTCGTCCGCCCCCTGCCGGAT
GCGGAGGTCATCGAGGGCATGACGGTGCAGAAGGAGTTCGCCCGCGCCGGCGCCATCGTCTCGGTGGCCG
CCAACCTCGATGAAGCCGACTCCTGGGGCGGGGCGTCCGGCTACCGGTTCGCCATGAGCCGCAGCGCGGC
CCTCATCTACTCGCTGCACCTGCGCGCCGTCGCCCGTGGGCTGGTGGGGACGGTCTTCGCCGGCTTCGCC
ACCTCGGCGGTGCGCCACCTGCTGGACTCCGACGGTGTCAGCCGCCACCAGATGTTCGCCGTCACCATCG
CCAGCCCGCAGGAGGCCCCACCCGACCAGAGGGCCGGCTAG
 Primer design

Protein Sequence:246 a.a.
>HMPREF9056_02778|ThioFinder984 Actinomyces sp. oral taxon 170 str. F0386
MRTDFETLRELVAGFSSGSGRRPGEEPTSDGLAGSRPRPPLDCRAPDVLVPGPQGAYPYDLHQTFERRSS
STSYGAEPLEAEPLLTMVRDALADDVRTWGEDAQACPLEPFILLLRPSGAEPGIYRVRLDGVDLVRPLPD
AEVIEGMTVQKEFARAGAIVSVAANLDEADSWGGASGYRFAMSRSAALIYSLHLRAVARGLVGTVFAGFA
TSAVRHLLDSDGVSRHQMFAVTIASPQEAPPDQRAG