Home 

Gene Symbol:  
HMPREF9056_02775
Organism:  
Actinomyces sp. oral taxon 170 str. F0386
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
24482..25855 [1], 1374 bp
Product Function:  
YcaO-like family protein
Product Locus:  
 ZP_08294857.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1374 bp
>HMPREF9056_02775|ThioFinder981 Actinomyces sp. oral taxon 170 str. F0386
GTGTACCGCTCTGCGCTCATTGAGGGTGTGGCGCCATCACTGGCTCGCGCTGCGTCCCTCGAGTCGCCCT
TCGGCCTGGTTTCCCGTTCCACCGAGCTGCCCCAAGCGGCCGGAGAGCCGGTCTTCGCGATCTGGACCGG
TCTTCTGGGTGATCCGTCTGAGGCGCTGAGGTCACAGCGCACCTGGAATCACCGTGCCGAGGCGGGCAAC
TTCGACGGGGCCGGCGGGGCCATCGACGCCGATCGCGCCAGACACATCGCGATCGTGGAGACGATGGAAC
GCTACTCCAGCTGCTCATGGACGGAGGAGGAGCTGGTGTGGGACACCCCCGCCGGTCTCGGCGAGGCCGC
GATCGGACCGGAGCGCTGGCCGGCGTGCTCGGCCGCCGAGCTGGCGGACCCCGACTGCGGGCTCATCGCC
TCAGACCCCCGCGTCCCCATGCGGTGGGTGCGCGGCTGGTCCCTGACCCGCGGCCGGGAGGTCTTCGTCC
CGGCCGTCCTGACATACCTCAACTTCCCGGTACGCACCCCCTCCGAGCAGTTCGTCAACCCCATCTCCAC
CGGTACCGCCGCCCACTCCGACCTGCGCGAGGCGGTCCTGGGCGGCCTGCTCGAGGTCATTGAGCGCGAC
TCCATCGCCCTGACCTGGCTGCAGCGCCTGCGCCTGCCGGCGGTCGCCGTCGATCCGTCCGCCCTGGGTG
AGGTGGCCGCCGAGTACCACCGGGTGGGCACCTCCACCGAGCTGGAGACCCACCTGTTCGACGCCACCAC
CGACTACGGCGTCCCCACCCTCTACGCCGTCCAGACCTCCCAGGTCGACCCCGAGCTGGCCCAGGTGGTG
GCCGCCACCTGCGACATCGACCCGCAGCGGGCGCTGGCCAAGATCCACCGCGAGCTCGCCTCCCTGCGCA
TCGCCCTGCGCAGCCACGCCCGCGGTCCGCGTGCCCAGGAGATCAAGGGCCAGGACCTCACCGTGGTCGG
CGGCGCCCTGGCTGACGCCGAGCTGTCCATGCGCCACGTCTTCGACTTCCTCCTTCAAGGTGAGCGGCCC
GTCCACGCCCTGGACGAGATCGGCGCCCTCGGGGCGTCGTCGGCCGGCACTGACGGCAGTAATGGTCCTG
ACCCGCTCGAGCAGGTCGTCGCCAACCTGGAGCGGGCCGGTGCCGAGGCGGTCGTCGTCGACATCACCAC
CGACGAGGCTCGCCAGGTCGGCATGCACGTCGTCAAGGCCCTCATCCCCGAGGCCATGCCCCTGTCCTTC
AGCCACCACGCCCGCTACCTGGCCACGCCCCGCCTCTACGAGGCGCCCCGGGCGATGGGCCTGACCGTCC
ACGACGAGGCGGGGATCAACCCCGTCCGCCAGCCCTTCGCCTGA
 Primer design

Protein Sequence:457 a.a.
>HMPREF9056_02775|ThioFinder981 Actinomyces sp. oral taxon 170 str. F0386
MYRSALIEGVAPSLARAASLESPFGLVSRSTELPQAAGEPVFAIWTGLLGDPSEALRSQRTWNHRAEAGN
FDGAGGAIDADRARHIAIVETMERYSSCSWTEEELVWDTPAGLGEAAIGPERWPACSAAELADPDCGLIA
SDPRVPMRWVRGWSLTRGREVFVPAVLTYLNFPVRTPSEQFVNPISTGTAAHSDLREAVLGGLLEVIERD
SIALTWLQRLRLPAVAVDPSALGEVAAEYHRVGTSTELETHLFDATTDYGVPTLYAVQTSQVDPELAQVV
AATCDIDPQRALAKIHRELASLRIALRSHARGPRAQEIKGQDLTVVGGALADAELSMRHVFDFLLQGERP
VHALDEIGALGASSAGTDGSNGPDPLEQVVANLERAGAEAVVVDITTDEARQVGMHVVKALIPEAMPLSF
SHHARYLATPRLYEAPRAMGLTVHDEAGINPVRQPFA