Home 

Gene Symbol:  
SSMG_08016
Organism:  
Streptomyces sp. AA4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
281399..282205 [-1], 807 bp
Product Function:  
predicted protein
Product Locus:  
 ZP_07283976.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:807 bp
>SSMG_08016|ThioFinder837 Streptomyces sp. AA4
ATGATTGACGCGGTGCTGCACCCAAAGTGGCGCTATTGGCGGGTTTACGTACCCGATCTCCAATCCGTTC
CAACCCTCTTGCGCGAGGTCGTGCACCCCGTCGTCACCTCGCACCGCGAAGGGTTGCGACGGTGGTTTTT
CCTGCAGTACATGGACATGTCGGGCCTGCAACTGCGCGTCCGGTTCAACCCGCGCCCCGAAGCCGCGGCA
GACGTCGAAGCAGACCTCGACCGCCGCTTCGCCGAACACGGCGCGGAAGTCGTGAAACGCTGGTACGAAC
CGGAATTGGCAAAGTTCCGCGGCCCGGACGGCGTGGAATTCGCCGAACGCGTCGCCCACCTCGGCAGCGA
CACCGCACTGGACCTGCTGCCCGCCCGCACCCCAGCGCGCCGCATCGCCTTGGCCGCAGCCCACACAGCA
GTCCTCGCCGCAGGATTGCCCGCCACGCAGCAAGTCAGTTTCCTGCACCAATACGCGTGGTACTGGTCAG
GCCGCGGTGCCCGAACCGTCGCGTGGCGCCCCGCCGCCGCGACCGCACACCCCGACGATCCGGCCGCCGT
ACGCCAAGCGAACCGCCTAGCCGAAACCGTGGCACGAGAACTAGAAACCGATTCCGTCGGAGGCCCGCTA
CGCCGCTACAGCGCCCGCTTCTGGGCGGAGTACCAGGATTCGGCCCGCCGCGTTTCGCCCTACCGAGCCG
CTTTCCAGCACGTACACCTCATGAACAACCGCCTAGGCGCAGTCCCCGGAGAGGAGGCCCAAATCGCCCG
GTTGTTGTGGATAGGGCGAGTGCGTAGCATGAATTAG
 Primer design

Protein Sequence:268 a.a.
>SSMG_08016|ThioFinder837 Streptomyces sp. AA4
MIDAVLHPKWRYWRVYVPDLQSVPTLLREVVHPVVTSHREGLRRWFFLQYMDMSGLQLRVRFNPRPEAAA
DVEADLDRRFAEHGAEVVKRWYEPELAKFRGPDGVEFAERVAHLGSDTALDLLPARTPARRIALAAAHTA
VLAAGLPATQQVSFLHQYAWYWSGRGARTVAWRPAAATAHPDDPAAVRQANRLAETVARELETDSVGGPL
RRYSARFWAEYQDSARRVSPYRAAFQHVHLMNNRLGAVPGEEAQIARLLWIGRVRSMN