Home 

Gene Symbol:  
SSMG_08017
Organism:  
Streptomyces sp. AA4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
282198..284429 [-1], 2232 bp
Product Function:  
predicted protein
Product Locus:  
 ZP_07283977.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2232 bp
>SSMG_08017|ThioFinder838 Streptomyces sp. AA4
TCAATCATGGGTCACCACCGTGAGGAATTCCGTGACGCGCCCGGGGGCCGCACCCGCGGCGGGCAGTGCT
TCGGTGAATTCGAGTTCCTCCGCACCGGCCAGGCCTTTCAGCGCCGTCCACGCCGCGAGCGGGCGGTCGA
AGCTGAGCCATTGCGGTTTGCCCAACGGTGTCCCGCCCGCGGCTAGTCCGCGGACGAACAGCTGCTCGGG
CAACCCGTGCTCGGCACGGAACATCCGGCCGGCGCGGAGGAAGTCGAGGTCGGGCCCGTTTCCGAGCGGC
GGGAGCGCCGACGCGGGCAGCGTCCAGCGGGCGCGCCGTAGTACGAGCCGTCCGTCCGTCATGCGGTCGC
GGAAGCCGGGGCCGGGCGTCGGGGTCCAGGAGCCGAGCGACAGCCATGGGTCCGAAAGCAGTTGCAGCAC
GCGGGGTATGCCCCGCAGCAGGTGTGCGGGCACCGCACCGAGGTAGCTCAACGCCGCGGGGCGTCCGGCC
GGGTCGAGGACTTCGAGCGTGCCGGTGGCCGGGTCGTGGCGTACGCGGAAACCGTCGATCGGCACGCCGC
CGTAGGCGCGTTCGGCTCCCCAGGCGAGGCACGGCGTGGCGCGTACGGCGGGGCGTTGCGTGTCCGTCCA
GTCGGCGTGCGCGGTCAGCTGGTAGACCACCGCGTCGGGAAAACGCCGTTCGTGCAAGGCGGTCATCGCC
GTTTCGACCTGGTCGGACAGACCTGGCACGCTGGCCCAGCGCGCGATCGCGCCGAGGTAACCGGGATGGA
CCTGGTTGAGCACCAGTGAGTCGCCCGCGACCTGCCAGAACACCGAGTGCACGGGTCGTCCGACGCTCGC
CCCGGACACCTCGCGCAGCTGCGGGTCGGGCACCGCGCACCGCGAGAGCCACCACATCGGGTCCAGCTCC
CGCACCGCGCGGAACGCGAACTCGGCGAGGTCGGCGCTGCCGTCGCGGTAGTGGTGCACGAAAAACCGGA
CCAGATCGAAGTAGCCCGCCCGCGGGCGCACCATCGAACGCAGCACGCCTTCGAGCCGGTCCAGTTCTCC
GGGAACCCAGGCGGGCGGGGCGGTTTCCGGCTCCGGGCCGTGCGCGACGGTTTCGTGGACCAGGCCGAGG
CCGTCCAGCCATCCCGCCCGGGCCGGATCGTGCTCGGCCATCGTCGCGCGCAGGCGCGAGCGCAGGGCCA
GTACGGCGTCGGCGCGCTCACGTCCGTTTCCGTTGCCAGCAACGACTTTTTCGGCTTCGGCCAGTGCGGG
CTCGCCCCACGCCGTGAAGTGCCGCGGTTCGGTCAGTTGCCACGGCGGAACCAGCAGCAGGAGGCCTTGG
TCCACAAGCCGGTGCAGCTCGTCGGTCGAGCATCCCAGCAAGGCGGCCAGTTCTCGCAGGCGACGGGGGC
GAGCGTCGAACGGCACCGGGCCGGGCAATGCCGTGACCTCGTCCTCGCGGAAGTACACGCCACCGCGCTT
GAGGTGGATCGGCAACGCGGCGAGCCACTCGTCACCGGCCAACCTGGTGTCCACATTGGGCAGCACGACC
GGGTCGCTGGCGAGTGCCGCGTAGGCGAGCCGCGCGGCGACGCGCGAGGAACTCACCAGCCTGCGCTCCG
GTCCGGGCTCGACAGCCCCGGCGAAGTCGCCGACGCCGACCGTGGTCAACGTGCCGAACGGGCTGGGCTT
CAGCGTGGTCCGCACCAGATACGACACCGCGCTGCGGCTCAGCCTGCCGCTCGGTTTGCCCAGCTCCGGC
CGGTCGGTGAAGGCCGTGACGAACTCCGGGCTGGCCAGCGCCAGCCCGGCGAGCACGTCCGGCTGGCGCA
ACGCGGCCGACACCGCGTGCTGCGCCGCCGCCAGCTCGCCGGTCAGTGCGCGAGCCGCCTTTTCCAACAG
CTCGCGTTCCCGCACCAGCGCCTGATGCCACTCGCCGAGCCGCTCCGCGTCCGCCGGTGCCAGCACCTCG
CGCGAGAGCCGGAGCCCGGCCTCGTCGGTGCGGTCGTTGAACACGCCTCGGCGCAGCCGGATCAGCGCGC
GCCGCTGGGCGCGCGACAGTTCGTCGCGGCCGATGACGGCGTGCAGCAGATCGCAAACCGGTTCGCGCAG
CGCGTTTTTGCGTGCCGCGGCGGCCTCGGCTTCTTCCAGCAGGGCGAGGGTCTCCGGGGCCCGCAGGCCG
TCGAGCACCGCGGCGGGCAGCCCGCAGATCCGGGAGACGAGCAGTTCGGCCACGGTCGTCAC
 Primer design

Protein Sequence:743 a.a.
>SSMG_08017|ThioFinder838 Streptomyces sp. AA4
MTTVAELLVSRICGLPAAVLDGLRAPETLALLEEAEAAAARKNALREPVCDLLHAVIGRDELSRAQRRAL
IRLRRGVFNDRTDEAGLRLSREVLAPADAERLGEWHQALVRERELLEKAARALTGELAAAQHAVSAALRQ
PDVLAGLALASPEFVTAFTDRPELGKPSGRLSRSAVSYLVRTTLKPSPFGTLTTVGVGDFAGAVEPGPER
RLVSSSRVAARLAYAALASDPVVLPNVDTRLAGDEWLAALPIHLKRGGVYFREDEVTALPGPVPFDARPR
RLRELAALLGCSTDELHRLVDQGLLLLVPPWQLTEPRHFTAWGEPALAEAEKVVAGNGNGRERADAVLAL
RSRLRATMAEHDPARAGWLDGLGLVHETVAHGPEPETAPPAWVPGELDRLEGVLRSMVRPRAGYFDLVRF
FVHHYRDGSADLAEFAFRAVRELDPMWWLSRCAVPDPQLREVSGASVGRPVHSVFWQVAGDSLVLNQVHP
GYLGAIARWASVPGLSDQVETAMTALHERRFPDAVVYQLTAHADWTDTQRPAVRATPCLAWGAERAYGGV
PIDGFRVRHDPATGTLEVLDPAGRPAALSYLGAVPAHLLRGIPRVLQLLSDPWLSLGSWTPTPGPGFRDR
MTDGRLVLRRARWTLPASALPPLGNGPDLDFLRAGRMFRAEHGLPEQLFVRGLAAGGTPLGKPQWLSFDR
PLAAWTALKGLAGAEELEFTEALPAAGAAPGRVTEFLTVVTHD