Home 

Gene Symbol:  
SSMG_08018
Organism:  
Streptomyces sp. AA4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
284426..285910 [-1], 1485 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_07283978.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>SSMG_08018|ThioFinder839 Streptomyces sp. AA4
ATGACCACGCTCGAACGCACCGCCGAAACCGTCGTCACCTTCCGCCGCGACATTTCCTTGCTGCACAAGG
ACGATCAGGTCCTGCTCGGGCTCGCCGACCGCGCGGGCTACCGGCTCAAGGGCGTCGGCGCGCCGATGCT
CGAAGCGCTCGAGCAGGTCCGCGCCGGCCTGCACACCGAAGAGGAACTGGTCGCCGAGCATCCGAACTCG
CCGGTCGCCTCCGTGCTGGCCAAGGTGGAACCGTTCCTCGCCACCGGTTTCCGGCTGCGCGGCGAGCGCG
TGGCCGTGCTGGAACGCACCGGCGTGACGCCGTTGCGGCCCGAACTGCCCGAGATCGCCGGCGCGTGGTT
GCGCCTCGGCAAGTTCAGCCTGCTGCGCCGTCGCGGCGGCGAGCTGGTGATCGAGTCGCCGATCGGGAAG
TACCGCGCGGTGCTGCTCGACGCGACGCTCGCCGGAGCCGTGGCCGGGCTCGCCGTCGCGCGGCCAGTGT
CCGAAGTGGACTCCGAATGGCATCCCGTGCTGGCCGCGCTGGCCGGGGCCGGCTTCCTCGACCTCGGAAC
CGACGGCGAGTTCCCGGCGGACCAGGACGACGTGCTGCGCCAGTGGGACGTGCACGACCTGTACTTCCAC
AGCCGCAGCCGGATCGGGCGCACCGACGAGGCGTTCGGCGGCCGGTTCCCTTACGTGGGGCAGATCGAGC
CGCTGCCCGCGGTGAAGCCCGCTCCGGAAGGCCCGGCGATCGCCTTGTACCGCCCCGAATTCGCCGCCGT
GCGCGCGGCCGATCCGGGCCTGCAGGAGACCATCGAGGCGCGCCAGTCCATCCGGACGTACGGCGAGCAG
CCGATCACCGCGGAGCAGCTCGGCGAGTTCCTGTACCGCACCGCGCGGGTGCGCGGCACGTACGGTCCGC
GGCCGGAGGCACGCATGCCGTACGAAGGTTCGAGCCGTCCGTACCCGTGCGGCGGCGCGGGTTACGAGCT
CGAGCTGTACCTGACCGTGCGCCGGTGCGACGGGCTAGAGCCGGGCATCTACCACTACGACGCGGGCGAG
CACGTGCTGCGGCTGGTCAACTCCGACGAGGCCGCGCGAGAGGAACTGCTGTCCGTCGCGACGCTGTCGA
CCGGCGGGCAGGCCGTGCCGGACGTGCTGGTGACTATGACGTCGCGCTTCCAGCGGCTCTCGTGGAAGTA
CCAGTCGATCGCCTACGCCGTGACGCTCAAGCACGCCGGCGCGCTGTACCAGACGATGTACCTGGTGGCG
ACCGCCATGGGCCTGGCCGGATGCGGGCTGGGCAGCGGGGACGCCGACGCGTCGGCCCGCGCGTTCAAGC
TCGACTACCTGCGGGAGTCGTCGGTCGGCGAGTTCATTCTCGGCAGCGCCCCGGCCGAACTCCCGGCGCC
GGTGAGCGGGGACGGCGCGCTCGACTGGCGCGCGGGCAACGACCCGGGCTGGCAGGCCGAGGCCCTGGCC
GCGCGGCGGCGGTGA
 Primer design

Protein Sequence:494 a.a.
>SSMG_08018|ThioFinder839 Streptomyces sp. AA4
MTTLERTAETVVTFRRDISLLHKDDQVLLGLADRAGYRLKGVGAPMLEALEQVRAGLHTEEELVAEHPNS
PVASVLAKVEPFLATGFRLRGERVAVLERTGVTPLRPELPEIAGAWLRLGKFSLLRRRGGELVIESPIGK
YRAVLLDATLAGAVAGLAVARPVSEVDSEWHPVLAALAGAGFLDLGTDGEFPADQDDVLRQWDVHDLYFH
SRSRIGRTDEAFGGRFPYVGQIEPLPAVKPAPEGPAIALYRPEFAAVRAADPGLQETIEARQSIRTYGEQ
PITAEQLGEFLYRTARVRGTYGPRPEARMPYEGSSRPYPCGGAGYELELYLTVRRCDGLEPGIYHYDAGE
HVLRLVNSDEAAREELLSVATLSTGGQAVPDVLVTMTSRFQRLSWKYQSIAYAVTLKHAGALYQTMYLVA
TAMGLAGCGLGSGDADASARAFKLDYLRESSVGEFILGSAPAELPAPVSGDGALDWRAGNDPGWQAEALA
ARRR