Home 

Gene Symbol:  
SSMG_08019
Organism:  
Streptomyces sp. AA4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
285907..288123 [-1], 2217 bp
Product Function:  
goadsporin biosynthetic protein
Product Locus:  
 ZP_07283979.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2217 bp
>SSMG_08019|ThioFinder840 Streptomyces sp. AA4
CTGGCCGGCCCGCTGGTCGAACGGCTGGCTCCGCTGCTGACCGACGGCCAGCTGAGCCGCGACGACATCA
AGGCCGCGCTCGCCGAGGCCGACCCCGCGCGCATCGACGTCGCGCTGGACCGGCTGGGCCGCAGCGGATA
CGTGGTCGAGGTCGACCCCGAGGTCGACCCGCGCGTCGGCGGCTACTGGGAAGCGTCCGGAGTGGACGGT
GACGACGCGGTGCGCCGCCTCGCCGCGGCGAAGGTGCGCGTGCTGACCGCGGGCGACGTCGACGCCGCCG
GGTTCACCGAGGCGCTGCGCGCGCTCGGCACCAGCGTGACCAGCGAGCCCGGCGGGTTCACCGTCGTGCT
CACCGACGACTACCTGCGCCCGGAACTCGCCGAATGGGGCAAGGAGTTCCACGAGGCCGGGGTGCCGTGG
CTTCCGGTGAAGCCGGTCGGCAGCATGATCTGGGTCGGCCCGGTTTTCGAACCCGAGGTCACCGGCTGCT
ACGAATGCCTGCGGGTGCGGCTGTCCAACAAGAACGTGCTCGCCTCCTACCTGCGCCAGCGCGGCGTGCT
CGACAGCCCCGCGCTGGTCAACTCCGTGACCGGCACCCCGGTGACCCAGGAGCTGGCGCACCGGCTCGCC
GCGCTGCACGTGGGCAAGTGGCTCACCGGCGCGTTCGCCGCGGGCCGGGCGGCGATGCCGCAGCCGCCGG
GCGGGGTCGCCGCGGAATACGGCACGCCGTGGCAGGCCGAGGTCCTCACGCTCGACACGATCAGCCTCAC
CCAGGAGCACCACCCCTTCCAGCGGCGTCCGCAGTGCCCGCTGTGCGGGGAGCCAGACCTGCAGGCGCGC
CGTCAGGAAACGCCCGTGCGGATCGAATCGCGTCCGCGGATGGCGAGCAGCGACGGCGGGTACCGCTCGC
GTCCGCCGGAGCAGTTCGTCGCCCGGTACGAGCACCTGATCAGCCCGGTCACCGGCCCGATCAGCAACCT
CGTGAAGGTGCCGCTGGAGGTCGAGGGCCTGCACACCTACACCGCGGGCCAGAACTTCGCGATCCCGATG
GCCAACGCCAACGACCTGCGGGCGGGGCTGCGCAGCTGCAGCGCGGGCAAGGGAATGAGCGACGCGCAGG
CCAAGGCGTCCGCGCTGGGCGAGGCCATCGAGCGCTACTCCGGCCTGTTCCACGGCGACGAAGCCCGCCG
CACCGCGCGCTACGCCGATCTGGACCCGGCCGAGGTGATCCACCCCAACGCGGTGCACCTGTACAGCGAA
GCGCAGTTCCGCGACCGGGCCGAGTGGAACGCGCGGCCGTCGCACTTCCACTGGGTCGCCGACGACCTCG
ACCCGAACGCCGAGGTCGAATGGTCGCCGGTGTGGTCGCTGACCGAACAGCGCACCAAGCTGTTCCCCAC
CTCCGGGCTCTACTTCGCTTACCACCACCCGAAAAACCGGTACCAGGCCGGAGCGAACTCCAACGGCTGC
GCCGCGGGCACCAGCCTCGAGGACGCGGTGCTGCAGGGCTTCATGGAACTCGTCGAACGCGACACGGTCG
CGATGTGGTGGTACCACCGGCTGCGCCGCCCGGCCATCGATCTGTCCACTTTCGACGTTCCGTACTTCGC
CGAATGGCAGCAGCGCTACGACGATCTGGAGCGCGACACCTGGGTGCTGGACCTGACGAACGACCTCGGC
ATCCCTTCAGTGGCCGCGGTTTCGGTCCGCCGCGACAAGCCCGCGCAGGACATCCTGTTCGCCCTCGGCG
CGCACTTCGACGTGGAGGTGGCGATCGGGCGGGCGCTGTCGGAGATGAACCAGTTCCTGCCCGCGGTGAT
CGGCATGAAAGCCGACGGTTCGGGGACCTACGCCTACAACGACCCCGACCAGCTGCACTGGTGGCGCACC
GCGACCACCGAGAACCAGCCGTACGTGCTCCCGGCCGAAGGCCCGCGGCGCACCAAGGCCGACTTCGCCC
GCTACGAAAGCACCGATGTCCGCGACGACGTGCTGCGCGCCGAGCGGATCGTCAGGGAGCACGGCATGGA
AATGCTGGTGCTGGACCAGACCCGCGTCGACATCGGCCTGCCGGTGGTGCGGGTGTTGGTGCCGGGCATG
CGGCACTTCTGGCCCCGGTTCGCGCCCGGCCGGCTGTTCGACGTGCCGCTGGAGCTGGGCTGGACCGACC
GCAAGCCGTCCGAAGCCGACCTCAACCCGATTGCGATGTTCCTATGA
 Primer design

Protein Sequence:738 a.a.
>SSMG_08019|ThioFinder840 Streptomyces sp. AA4
MAGPLVERLAPLLTDGQLSRDDIKAALAEADPARIDVALDRLGRSGYVVEVDPEVDPRVGGYWEASGVDG
DDAVRRLAAAKVRVLTAGDVDAAGFTEALRALGTSVTSEPGGFTVVLTDDYLRPELAEWGKEFHEAGVPW
LPVKPVGSMIWVGPVFEPEVTGCYECLRVRLSNKNVLASYLRQRGVLDSPALVNSVTGTPVTQELAHRLA
ALHVGKWLTGAFAAGRAAMPQPPGGVAAEYGTPWQAEVLTLDTISLTQEHHPFQRRPQCPLCGEPDLQAR
RQETPVRIESRPRMASSDGGYRSRPPEQFVARYEHLISPVTGPISNLVKVPLEVEGLHTYTAGQNFAIPM
ANANDLRAGLRSCSAGKGMSDAQAKASALGEAIERYSGLFHGDEARRTARYADLDPAEVIHPNAVHLYSE
AQFRDRAEWNARPSHFHWVADDLDPNAEVEWSPVWSLTEQRTKLFPTSGLYFAYHHPKNRYQAGANSNGC
AAGTSLEDAVLQGFMELVERDTVAMWWYHRLRRPAIDLSTFDVPYFAEWQQRYDDLERDTWVLDLTNDLG
IPSVAAVSVRRDKPAQDILFALGAHFDVEVAIGRALSEMNQFLPAVIGMKADGSGTYAYNDPDQLHWWRT
ATTENQPYVLPAEGPRRTKADFARYESTDVRDDVLRAERIVREHGMEMLVLDQTRVDIGLPVVRVLVPGM
RHFWPRFAPGRLFDVPLELGWTDRKPSEADLNPIAMFL