Home 

Gene Symbol:  
BC059799_0521
Organism:  
Bacillus cereus NVH0597-99
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
35654..38158 [1], 2505 bp
Product Function:  
lantibiotic dehydratase family protein
Product Locus:  
 ZP_03108674.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2505 bp
>BC059799_0521|ThioFinder925 Bacillus cereus NVH0597-99
TTGAAATATGAGATTTTAAAAAACCCAATAGTTCTGTATAGAGGAAGTGACGTTACAAAAGGTTGGTACA
ATGAAATGATGGCAACATCAGCTTCATTACAGGATGTATTACATGTCATAAAAAAAAATGAAGATCAATT
AGCAATAATTAAAGAAAGACTAATTGTTAAGATTGAAAATGAATTTGCTTTAGTAAAAGAGATGAGTTTA
TTAAATTTAAAAAGAGATATTCATAACATAAGGATAGGTCGTATAGAGAAATATATTAAAATATGTAAAA
ATACTGAATTGAAATCTATGCTTGGGGATTTTGTTGACCTATTAGCACAAAATGCAAAACTTACTGAAGA
ACTTGCTGAGGAATACACACGTGTATTGAAAGCTAATAGAGAAATCTTGCAAAAAAGTATAGATGATGAA
GAAGTTTTAAAATCTATCGTATTTTATAATAATGAAATTTATCAAAAAATTAAGAAATATACAAGTGAAG
AAGTTGAAAAACATAGTAAGAAATTAAAGAAATTGGATTATTTTCTTCTGAAAATGTTAGTTCGTTCTTC
AATGAAAACAAGTCCATTTTCTCATCTAACAAAAACAGGACTGGTCTCTAACACCGAAGAGATTGAATTC
GAAAAAACATCGTATAGTGAATTGAATCATGCGGTTATTTTACAAACGATCCACCGTTATCTACGAAGTA
ATGAACAAGCATTACAACGTATTCCAGTGAAAGTAGAGAACTTTGGAAGCAAAGAACAAGGTATTTATTA
TGTGACACAAAATGATGTGGAACAATCAAAGAAAGTATTAGAGACTAGTGATAAATTTGTTGAATATAAA
CTTGATGAAAAGTTAATTCAATTTTTACATGAAAATAAACAGAAAGTAATTGGGTTTGAACAATTTAAAC
AAATAGCAAGCAAGATTACGATTTACCAAGGAAAAGAACTTCAATTATTTCGTAAGTTAGTCGAATTGAA
GTTATTACGACAGTGTATAACAATTCCAAATAATAGAGGGATCATTACTTCTATCATTCAATTTTTAGAA
GAATATGAAGTAGGAAAAGAAATAATACCTTTATTAGAAGAGTTACATGCTGCATTACATTCTTTTGAGA
AAAGTAGTTCTTTTGAGCGGATCAATGATTGGAATGAAATAAAAAGAATTCTCTCATTACTACAAAAAGG
GGATAAAAAGGTTGGTAGTGAGATTATATATGAAGATGTAATCTTTAAAGATGTTCGAAAAGATACCATT
ACACCTAAGATTCGTAAATCTTTTTTAGAGGGGCTAGCTGATTTCATCTTATTATTTGATGTCAATGTGC
GTGTTCAATATGAGATAGCTCAATTGTTTTATGAGAAATATGGAAAAAGTACTGAAAAACTATCGAATAG
TAATTTGTTAAATGAAGTTTTCTTTCGTGAAATTCATCAATTTTATCCATATTATCAAAACCAGAAATAT
CGTTATAAAGAAGCGAAAGCAAAAGAAATTCAGCAGTTGGATGAACTTCGAGATCAATTTTTGAAAGAAT
TTGAATCGCTTATTTTAAACGTAGATCAATCAGTAGAAGTAATCGATATTGAACTGTTAATCGAAAAATA
TACGAGCCTTATTCCAGAATATATAAAAAAGGATAGTAATATTTCTTATACACTATTTTTGCAAGAAACA
ACTGATGAAAATATTGTGCTTAATAATGTATATGATGGCCAAGAAAAATTCATATCACGATTTAAAGATT
TTTTCATGCCGCATTATGAAACAAAGGAATATTCGAATTATATAGAGCGTGTACTTAATGAAGATAACTG
TTACGAGGTAGATGAATTATTTGGATTTAACGGTGGAATTCATGAAAGAAAATCTCATAATATCGTCAAT
TTAGATGTAGGTTATCAACGATTTAATCATAAGGATGCGAAGCAAGTAAGAGATTTTAAAGTACGTTATA
ACACAGAAAGGAAAAAAATAGAATTTCTAGATGATAATTACAAAATATGTAATTTAGTGTATAAATCATC
ACTTGTTCCAATGTTTTTACCTGGTATTTTATCTGTTATGTTGTATCTATTTCAATCAGGGAGATTAAAT
TTTGATATTACTTCGCTGGTAAAAGAAGAAAATTATGTGCCACGAATTACGTTTGGTAATGTAGTTTTAT
CAAGGAAAAAATGGAAGGTGATAATGGAAGATCTAAAGGACATTTTAGAATCAAAACTAGAAGCACATGA
ATTATACGAGGAATTAAATGGGTATTTCAAGCAAAAACAATTACCAAAACAATTTTTCCTTAAACATTAT
CGTCAAAATGGAGATTTTATGGTAGAAAAACCAATATTTTTTGATATTGAATCACCGGTCATCATGAAGT
TCTTTATACATGAGATCCAAAATGCGATTGAAAATTCAGGAGCATTATATATAGAAGAAGTTTTGCCAGA
AGTAAATATCCCACTTAATGAATATTTGATTGAATATTCGTTCAAAAAGGAGTAG
 Primer design

Protein Sequence:834 a.a.
>BC059799_0521|ThioFinder925 Bacillus cereus NVH0597-99
MKYEILKNPIVLYRGSDVTKGWYNEMMATSASLQDVLHVIKKNEDQLAIIKERLIVKIENEFALVKEMSL
LNLKRDIHNIRIGRIEKYIKICKNTELKSMLGDFVDLLAQNAKLTEELAEEYTRVLKANREILQKSIDDE
EVLKSIVFYNNEIYQKIKKYTSEEVEKHSKKLKKLDYFLLKMLVRSSMKTSPFSHLTKTGLVSNTEEIEF
EKTSYSELNHAVILQTIHRYLRSNEQALQRIPVKVENFGSKEQGIYYVTQNDVEQSKKVLETSDKFVEYK
LDEKLIQFLHENKQKVIGFEQFKQIASKITIYQGKELQLFRKLVELKLLRQCITIPNNRGIITSIIQFLE
EYEVGKEIIPLLEELHAALHSFEKSSSFERINDWNEIKRILSLLQKGDKKVGSEIIYEDVIFKDVRKDTI
TPKIRKSFLEGLADFILLFDVNVRVQYEIAQLFYEKYGKSTEKLSNSNLLNEVFFREIHQFYPYYQNQKY
RYKEAKAKEIQQLDELRDQFLKEFESLILNVDQSVEVIDIELLIEKYTSLIPEYIKKDSNISYTLFLQET
TDENIVLNNVYDGQEKFISRFKDFFMPHYETKEYSNYIERVLNEDNCYEVDELFGFNGGIHERKSHNIVN
LDVGYQRFNHKDAKQVRDFKVRYNTERKKIEFLDDNYKICNLVYKSSLVPMFLPGILSVMLYLFQSGRLN
FDITSLVKEENYVPRITFGNVVLSRKKWKVIMEDLKDILESKLEAHELYEELNGYFKQKQLPKQFFLKHY
RQNGDFMVEKPIFFDIESPVIMKFFIHEIQNAIENSGALYIEEVLPEVNIPLNEYLIEYSFKKE