Home 

Gene Symbol:  
BC059799_0528
Organism:  
Bacillus cereus NVH0597-99
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
45027..45758 [1], 732 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_03108593.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:732 bp
>BC059799_0528|ThioFinder932 Bacillus cereus NVH0597-99
ATGAAGTTATGGGACTTTAAGGTAGATGTAGCACCAAAGTTTATTGACTATCATTATGCATCAATAAATG
ATCCAGCTTATACAATGACGCAAGTCTATAAACATCGGGAACGAACTCCTACTATCGAGAAACAGTCTAA
TAGTGTCCCTTTAGAATATAAAATCCAAGAAGAAAATGAATTTGAAAAAATATTATTAAATCGTCATTCA
TGGCCTATGCCATTTTTAAACAACCAACATATCAATTTAGACTTGATAGCAAAATTTTCGCAATTGGCCT
TTATTGGAAATTCTAAAAGGAACCGTAATTATCCTTCAGGTGGAGCGCAATATTTAGTCAACATTCATTA
TTTGTTTAATAATAACCGAGTAGATCAGGATGTTATACAAGCGGGAACTATTTGTAGACTTAATATGGAT
AATCACACCTTAATAGGTGAAAGATTTGTCGATTGGGATATTATTCGAAAAGCATTTATTGCACAAGCAG
GAGCAGCTACAGCACAGTTCGCCATAGTATTAAGTGTAGATTTAATGAAAATCTCTGAGAAATATACGGA
TATTTCATATAAACTTGTTCAGCAAGAAGCGGGACATATTGGACAAAATATACAACTCGTAGCTGAGTAT
TTGAATATTAAATCTTTGCCCCTAGGTGGCTTTTATGATAATGCAATGAATAAACTCATAGGGAATTCTA
AAACAACTTTATATACACTTTTATTAGGGTAG
 Primer design

Protein Sequence:243 a.a.
>BC059799_0528|ThioFinder932 Bacillus cereus NVH0597-99
MKLWDFKVDVAPKFIDYHYASINDPAYTMTQVYKHRERTPTIEKQSNSVPLEYKIQEENEFEKILLNRHS
WPMPFLNNQHINLDLIAKFSQLAFIGNSKRNRNYPSGGAQYLVNIHYLFNNNRVDQDVIQAGTICRLNMD
NHTLIGERFVDWDIIRKAFIAQAGAATAQFAIVLSVDLMKISEKYTDISYKLVQQEAGHIGQNIQLVAEY
LNIKSLPLGGFYDNAMNKLIGNSKTTLYTLLLG