Home 

Gene Symbol:  
BC059799_0525
Organism:  
Bacillus cereus NVH0597-99
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
41141..42865 [1], 1725 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_03108686.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1725 bp
>BC059799_0525|ThioFinder929 Bacillus cereus NVH0597-99
ATGAAAGTAAAATATATAACAGATTTAGCTAATTATCATGAAGTAGGAATTGGAGAAATATCAGTTTACT
TTAATAAACAATTTATATTTATTGGTCCTATTCGCACCTATAGTTCTGCTTGTTTTAATTGTTTTCAAGA
ACGAGTAAAAGAGCAGAAATTAAGTGAATATTATTTTTCTACTGCTAAGCATTTGGCACTTAATGATGTG
GAAGAAGAGATCGTAAAATCATATTTAGAAAAAATTGCAGATGAAGAAGAACAAGGCATCATTTATATTT
TTAATCGAATTACAAAAGAATGTGAATTAGTAAGCACATTTAAAAGAGGAGATTGTCTACACTGTTCATC
TGACGATATCAATTATGTAAAGAGAGATAGTAAGAAAGAAGGATATCTATTTGAAAAATTAAACCCTCGT
CAAGATAAATGGGAGAATGTAAAAAATCGATTACAGAAGTTTAAACCACTTCTTTATAAAAATAGGTTCT
CTTTAATTAATAGAATCAATAGATCTGGTGATTCTTATGGATTACCTATGGTAGAAACAGAGGTATATTA
TAAAAATGTTTCTATGCTATCTTATGGTAGAACAAGTACATATGAAAAATCGCGTTACACAGCTATTTTA
GAATCATTAGAACGTTATGCAACTGCTTTTCCATATAAAAGATCTCCTTACCATTTTCGGGAGAAGGAGA
ATGAAAATATTGATTTAAAGATTTCAGAAATCATTGAGTTAAATAATCTTGAGACGGGTGAATATAGTGC
GGATACTCCTATCTATTATACAGAGGTAGATGCCTTGCATAAGAGAAAGAAAGCATTAATCCCAGAGCAA
ATTGTGTATTTTGATTCACATCATTCTTCGGATGAGAAGCGATATATTTTTGAAAGCTCGAATGGAAGTG
CATTAGGATCTACTCTTGAAGAGGCAAGTTTATTTGCAATGTTGGAATTGTTTGAACGTGATTCTTTCTT
ATGTACATGGTATGGAAAAATCCCGCCAATCCGCATTGAAACAGAGTCTTTAAAATCATCAAAGATTCAA
AACTATATAGTAGCTTTGCAAAAGAAAGGTATTAAAGTTCATGTTTTTGATATTTCTATAGAATTAAAAA
TTCCTACAATATGGGTATTACTTGAAAAGCAGGATCCTAAAGAAAGTGATATGGCATTTTATACAGCTGC
AGCTACATCGTTTGATTTAGAAGATGCAATTGAAAAAGCATTAATTGAAGCAACAACTGCCATTTCTGTA
TTTTCTAATTTATTCCGAGGAGAAGATTTTCAACAGAGAAAAAGAATGCTTTTAAAGGATCCAACTAAGG
TAAGTAGACTAGAAGATCATTTATTACTGTATTCTAATCAAGAAATGAGATCATATTTAGAATTTGCACT
TAATACGCCATATCATATAACAGATGATGAATTAGAAAAATATTATTTGGAATTTAACGGGAAATATACG
GAAGTATTAGAGTATTTCCATGGGAAAATATTAGAAATTTCAGATAAGGCGTACCGAGCAGCTACAGAAA
ATATGAATTTAAATGAATTAGGGTTTGTTAATGTGAAATATGTTGTCCCTAAAATGTTAACAATGACATT
TGGGCATCAAAATAGAAGAATCGTGAAATCAAGAGTGGAAAAAGCAATAGCGTATAAGGGAAGAGGGTAT
GTGGATACAGAGTGGATGGAAAAAATCCCACATCCATTTCCTTAA
 Primer design

Protein Sequence:574 a.a.
>BC059799_0525|ThioFinder929 Bacillus cereus NVH0597-99
MKVKYITDLANYHEVGIGEISVYFNKQFIFIGPIRTYSSACFNCFQERVKEQKLSEYYFSTAKHLALNDV
EEEIVKSYLEKIADEEEQGIIYIFNRITKECELVSTFKRGDCLHCSSDDINYVKRDSKKEGYLFEKLNPR
QDKWENVKNRLQKFKPLLYKNRFSLINRINRSGDSYGLPMVETEVYYKNVSMLSYGRTSTYEKSRYTAIL
ESLERYATAFPYKRSPYHFREKENENIDLKISEIIELNNLETGEYSADTPIYYTEVDALHKRKKALIPEQ
IVYFDSHHSSDEKRYIFESSNGSALGSTLEEASLFAMLELFERDSFLCTWYGKIPPIRIETESLKSSKIQ
NYIVALQKKGIKVHVFDISIELKIPTIWVLLEKQDPKESDMAFYTAAATSFDLEDAIEKALIEATTAISV
FSNLFRGEDFQQRKRMLLKDPTKVSRLEDHLLLYSNQEMRSYLEFALNTPYHITDDELEKYYLEFNGKYT
EVLEYFHGKILEISDKAYRAATENMNLNELGFVNVKYVVPKMLTMTFGHQNRRIVKSRVEKAIAYKGRGY
VDTEWMEKIPHPFP