Home 

Gene Symbol:  
Clocel_3629
Organism:  
Clostridium cellulovorans 743B
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4403052..4403885 [-1], 834 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003845064.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:834 bp
>Clocel_3629|ThioFinder627 Clostridium cellulovorans 743B
ATGATATGGCATACCATTTATATTTACTGTCATGAAACAGTAAAGCAGGAAGAGCTAATGGTAAAGCTTA
AAAGAATTTTAGATAAATCTAAGGAAAAGTGGTTTTTTATTAAGTATTGGCATGGAGGTCCACATGTAAG
ACTTCGATTCCAAGAACAAGATGAGCAATTCAGAGTAGAACTAGAAGAAGAAATTAAAAACTTTTTTAAA
AATAACAAAGTAAATAATGTAGATAGAGATGTTTTCTATAGCTTTAATAATTTTGATGGTGAGGATGTTG
ATCCTGATACTCTTCCATGGTATGAGTCAGGGGACTATTTTTATACAGAATATATACCAGAGATTCGTAG
ATATGGAGAAGGAAATATTCTTGAAATGAACGAAAGCATATTTCATGCATCTTCTCTTTTAGCTTTAAAG
GTTTTTGAAAAAGCGCTATCTTATAATTCCAGAATAGTATTAGCAGCTTATATTATTAAGAGAATATTAT
CTGAAACAATATCATTAGATATGGATTTCCTTGATCAATACCAAGCTTATTGGAAGTCCATGGCAGGAAA
ACTTAAGAAAGAGAATACCCAAGCATTGCAGAAAATAATGCATATGGTTATGGAAGAACAGCTTCCCTTT
TCTTTCTTAGAAGAGAATATAGATATGCTAATAGATAACATGATAATTCTAAAACAAGAGTTGGCAATGG
ATGAATTTAAATATGTTCTTTCTTCCCAAATACATATGATGAACAACAGAATTTCTGTAACACCAGAGTT
GGAATATGTTATTTCTAAAAATATGAGGGAGTACATTTATGAAAAAATGGAAGCTTGTAGATAG
 Primer design

Protein Sequence:277 a.a.
>Clocel_3629|ThioFinder627 Clostridium cellulovorans 743B
MIWHTIYIYCHETVKQEELMVKLKRILDKSKEKWFFIKYWHGGPHVRLRFQEQDEQFRVELEEEIKNFFK
NNKVNNVDRDVFYSFNNFDGEDVDPDTLPWYESGDYFYTEYIPEIRRYGEGNILEMNESIFHASSLLALK
VFEKALSYNSRIVLAAYIIKRILSETISLDMDFLDQYQAYWKSMAGKLKKENTQALQKIMHMVMEEQLPF
SFLEENIDMLIDNMIILKQELAMDEFKYVLSSQIHMMNNRISVTPELEYVISKNMREYIYEKMEACR