Home 

Gene Symbol:  
Clocel_3634
Organism:  
Clostridium cellulovorans 743B
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4409214..4411727 [-1], 2514 bp
Product Function:  
Lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_003845069.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2514 bp
>Clocel_3634|ThioFinder632 Clostridium cellulovorans 743B
ATGGAAAAGAAAGAGAAAATAAAAAAAATTCACATTCATCCTTTTAATATCTGTAGAGAAAAGCAACCTT
TAGGAAATTTTTTGAAGGTTACAAATAAGAATAATCTTTATGAAGAAATTGAAAGGGTCAAAGAACAACT
CATTAGTGATTCTAATGAGTTATTTAAGGATATATCAGAGAATTTAATACATAGGGACAATGAAAAGAAA
AAGCTTTTGAAAAGTTTGAAAACTTTAAGACTAGATTATCCCTTTAAAGATTATGTATCTGGAAATGAAA
GAATTCAAGGGAAACTTACGGAGTTTCAAGAAAAGATAGATAGTTTAAATGAAAAGCTTCAGTGTTTTGA
AGAATCTTTTAATAAAGATTATTTAAATAATAGATATGAACTAAGGAAGCTTTTCAAAGAGAATAAAGAA
ATTTATGAATCACTTTATGTGGTGAACCCTGATATTTATCCAAAGCTTGATAGTTATCTTAATGATTTTC
AGTCAGATAATAATAAGTTAAGGAAACTTGAACTAGTTTTAATGCGTATTGCTACAAAAGCAACTACAAA
GACTAGCCCTATTGGTAGAATGAATCGTGTTTCCATTATAGGTAATGGAGAAGAGAGAAAATATGAAATT
GATACGAATCAAATTTCAGTTAATAATGTTTTTTTATTTAGAATTTTTGAAGCTTTTCTTTTAAGTGAGG
ATATAATTAGACAAGCTAAGTTTACTATAAATAAGAATTATTACTTTGTAGATAAAGATTTATATATAAT
AACTCAAATTTCAGAAAATCGAAAGGTTTTTAATACTAAAGACCGTTCAGTAAAGATTGCAATGAATCAA
TATCTTCAAAGGTTTTTAATGGAAAAAGACTTAAGTGAAGTAAGTGCTGAAAGACTAAGGAGAATATTTC
CTGTTAAGGATGAGACGATAGAGAAACTTTTAAGGAATTTTTACGGAATAGGACTAATTAAGTTTAAAGA
ATATTTTTCTGATGTTTATGATTCTATAAGTAGTCTTTTATGGTCAATTGGAAAATATGAAATTCCTTCT
GATAGCAAATGGAATCAAGTTATATTCCAATTGAAGGAGATTAATAAAGATATACAGGAACTAAATATCA
ATTACAGAAATGATATTAGACAAAAAATTCTTAATAGATTCTATAAAATTTCTGAGTTAGCTGGTATTGA
TAGATTCAAAGAGAATGAATACCTATACGAGGATTACTTAGTGAAAAAAGAAGGTTTTTTAGTTCATGGG
GAAAAGTTATCTGAAGATTTATATAAACTTTTAGAACTATATCCTTTATTTGATATTAATACTCGTATAC
AATTAGATGCTTTAGAAGAAATTAAAAAAGCATATAATGACACTAAAGTAAAAGTTAGTGATGACCATAT
TTTTCAGATAATAGCAAATACAAATGTTCATTATAGTTCATATTGGTATGACCCATGGGGTGAAATCGAC
AGTGTAAGTGAAGTAGGTAAACTATTAGATAAAATGAAGCAAGAATGGAAAAGTTATTTGCTTAATCAAT
TTGAAAAAATCAAAGATGGGAAAGGTAAAAAGGTTGTTGAGATTGAAGAGGGATTCATAGCTAGTTTAAC
AAGTCGAATTCCAAATGAATTAAGAGAAAATGATGTATCATATAGCCTATTTTATCAGATGCAAGATGAA
AAAATGATCATAAACAAAATATATCCAGGATACATGAGTTTTTATAATAGATTTTTACGTTACACAGATA
TTGTAGAAAAATATAAACCACTTCTTCAGGATTTTTATTCTTCTGAAAAATATGATATGGCAGAAGTATA
CGAAACATTTGGATTTAATGCTAATGTGTATAATCCTATGTTTGATACAAGAATAACTTCAGATTTGACC
AGAGATGAAAATATGAATGATGCTTTCAAAACAGTGAGAAAGTTTGAGGATATGACTATCAAAGAAGAAG
AGGGAAAATTATTTTTAGAAGATGATCTAGGAAAGCTTTATAAGCCTGTTATTAGTACAAGCCTCATTCG
TGTATTATATCCTGGTTTTATAGCCTTTTATACATCACTTTTTTCTAATATAAGCCATGTTTCAGAATTA
GCTAGTATATTCTTTAAAAATTTGAAAGAAGGAAAGATTTTTGAATGTCCAAGAATAGTTATAGGGGATA
TTGCCTTAGAAAGACAAAAGTTCCTATTTAATACATCAATGCTTCACCATATAGAACATCTAGATAATAT
CGAAGCTTTTTTAACACTTAGAGAATTTTTCAAAAATCATGGTATTCCTTTGAAATTCTTTTTTCAGACT
CGTAAAAAACCTTATGAGGATGATTCAGTTAGAAGTGTTTCAGTGGAATTTGATAAGCCGCAATATTTTG
ATTTAGAAAACATATTACTTTTAAAAGTATTTTTAAATGCTTTGAGAACCTCAAAAATTATTATGATCAG
TGAGATTTTACCTGAAAATATTGAAAGTTGTGAATACTTGACTGAGTTCAATTTGAAGGAATGA
 Primer design

Protein Sequence:837 a.a.
>Clocel_3634|ThioFinder632 Clostridium cellulovorans 743B
MEKKEKIKKIHIHPFNICREKQPLGNFLKVTNKNNLYEEIERVKEQLISDSNELFKDISENLIHRDNEKK
KLLKSLKTLRLDYPFKDYVSGNERIQGKLTEFQEKIDSLNEKLQCFEESFNKDYLNNRYELRKLFKENKE
IYESLYVVNPDIYPKLDSYLNDFQSDNNKLRKLELVLMRIATKATTKTSPIGRMNRVSIIGNGEERKYEI
DTNQISVNNVFLFRIFEAFLLSEDIIRQAKFTINKNYYFVDKDLYIITQISENRKVFNTKDRSVKIAMNQ
YLQRFLMEKDLSEVSAERLRRIFPVKDETIEKLLRNFYGIGLIKFKEYFSDVYDSISSLLWSIGKYEIPS
DSKWNQVIFQLKEINKDIQELNINYRNDIRQKILNRFYKISELAGIDRFKENEYLYEDYLVKKEGFLVHG
EKLSEDLYKLLELYPLFDINTRIQLDALEEIKKAYNDTKVKVSDDHIFQIIANTNVHYSSYWYDPWGEID
SVSEVGKLLDKMKQEWKSYLLNQFEKIKDGKGKKVVEIEEGFIASLTSRIPNELRENDVSYSLFYQMQDE
KMIINKIYPGYMSFYNRFLRYTDIVEKYKPLLQDFYSSEKYDMAEVYETFGFNANVYNPMFDTRITSDLT
RDENMNDAFKTVRKFEDMTIKEEEGKLFLEDDLGKLYKPVISTSLIRVLYPGFIAFYTSLFSNISHVSEL
ASIFFKNLKEGKIFECPRIVIGDIALERQKFLFNTSMLHHIEHLDNIEAFLTLREFFKNHGIPLKFFFQT
RKKPYEDDSVRSVSVEFDKPQYFDLENILLLKVFLNALRTSKIIMISEILPENIESCEYLTEFNLKE