Home 

Gene Symbol:  
Clocel_3631
Organism:  
Clostridium cellulovorans 743B
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4405278..4406918 [-1], 1641 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003845066.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1641 bp
>Clocel_3631|ThioFinder629 Clostridium cellulovorans 743B
ATGAGTAGAAAAGAAAAGATGTTAGAGTATACAGATCGAGTATTTTTTCTAGAAAAAGAAGTAGATGAAA
AACAAGTTGCAAAGAATTTGCAAAGAAGAATTTTTGTAAACAAAAACATTACTCTCATCCCTAAGGAAGA
GGAGCCTATAGAACCACTTGATAAGGTAACAGATGTTATTAAGTATGATTTTAGTGAAATTATGAAAAAT
AACGTTACAGAAAAGTCTTTTTATGAGATTCATTTTAGAGACTTTCAAGTTCAAGGTTTTACTTTAGATA
TTGCTTCAAAAAATGTATATGTCAGAAATAATTTAGATACATCTTTTGAAGATGAGGTTTATGATAAGAA
AACTTTAAGGGTAAGGAATAAGGTAGATCTTTCGGGACTGAAGAAAGATCAATTTGATGAACGTTATGGG
GTTATAACAAATATATATAAATATTTAGGAACTCATGATATAGCACTTGTAGGAAGTGAGTTTGTACATA
ACAAATCAGTTAACTTCTCCTATGGTAGAGAAAAGGAATTTGATGCAGCAGAGACCAGTGCTTTACTAGA
ACTTTTAGAAAGAAGAGCTATGTATGAAGTTGAGGGGGAGAAAATTCATACAAGCCTTGAAGAAGATGAT
GCAAATATTTTAGTTAATCCAGAACCTTTTTTATATTACGATCCTGTAGACGCAATAGTTGCTCCTTTTG
ATAGAAAACGTAAGTATACTTGGCTTAAGGTACTAGATTATAAAAAGAAAACTTTTAAGTATCTTCCACT
TCAATTTTTTGATATGGATTGCGGCGATGAGCCAACTTTTGTATTGGAATCTTCTAATGGAGTAGCTCTT
GGTGGGTCATTACAAGAATCAAGACTTTTTGCTTTATTAGAACTAGTTGAAAGAGATGCTTTTTTAAATT
TTTGGTATAAGAAAGTAAAGGTTTATGAAATTGATCGCAGTTCTATTCCTGAGGCGTCAAGAAAAGAAAT
AGAAATCTTTGAGAGGGAAGGAAGAACGGTATATCTTCTGGATATTACTTTTGATATAGAAATTCCAACA
GTATTATGTATTGTAATATCTGAAATTGATTCAGTGAGCACTTATATTAGTACTGCATCACATATTAATC
CAGAGATTGCGATTAAGAATGCTATTTATGAATGTTTAGTTGGTCATAGAGTTTACAGTAGTAACGAGAC
CATGAGTAAGAAGACATATAATAATGATTATGATGTGGTGGATATGACTGATCATGTGAGTCATGCCGCT
AAGAAGAGTTACATAGAAAATTATCGTTTCCTAATGGATGGATTAGAAAAGAAATCTATAAAAGAACTTT
ATAAAGAATATTATGATGGAAAATATGATAGTTTTAATAATGCTTCAGAACTATTAGATTATTTACTTTA
TGAAAAGATGAAAGACCAGGAAGAAATTTATTTTGCAGATCTTACTACAGAATTATCTTATAAAAATGGT
TTTTATATATCCAAAATAGTTTCTCCTAAGATGTTAGCGATGACTTTTGGACATAGAAATAGGAGAATCA
ATAAAGAAAGAATTGAATGGGCATTGTCTCATTCAAAATATAAAGATAAAAGTTGTTTAGAAAGAGGGAG
TATTAATGAGCGAGTACACCCGTTCCCTTAA
 Primer design

Protein Sequence:546 a.a.
>Clocel_3631|ThioFinder629 Clostridium cellulovorans 743B
MSRKEKMLEYTDRVFFLEKEVDEKQVAKNLQRRIFVNKNITLIPKEEEPIEPLDKVTDVIKYDFSEIMKN
NVTEKSFYEIHFRDFQVQGFTLDIASKNVYVRNNLDTSFEDEVYDKKTLRVRNKVDLSGLKKDQFDERYG
VITNIYKYLGTHDIALVGSEFVHNKSVNFSYGREKEFDAAETSALLELLERRAMYEVEGEKIHTSLEEDD
ANILVNPEPFLYYDPVDAIVAPFDRKRKYTWLKVLDYKKKTFKYLPLQFFDMDCGDEPTFVLESSNGVAL
GGSLQESRLFALLELVERDAFLNFWYKKVKVYEIDRSSIPEASRKEIEIFEREGRTVYLLDITFDIEIPT
VLCIVISEIDSVSTYISTASHINPEIAIKNAIYECLVGHRVYSSNETMSKKTYNNDYDVVDMTDHVSHAA
KKSYIENYRFLMDGLEKKSIKELYKEYYDGKYDSFNNASELLDYLLYEKMKDQEEIYFADLTTELSYKNG
FYISKIVSPKMLAMTFGHRNRRINKERIEWALSHSKYKDKSCLERGSINERVHPFP