Home 

Gene Symbol:  
Clocel_3633
Organism:  
Clostridium cellulovorans 743B
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4408156..4409202 [-1], 1047 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003845068.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1047 bp
>Clocel_3633|ThioFinder631 Clostridium cellulovorans 743B
ATGTATCATAATTTGAAGATATATTTGAATATTGAGTCAGAGAAAAAGAATGATTTTATTGCAGAAAAAC
TTATTCCTTTTTGTAGGGAAGTAATTAAGAAAGATTATTATTTTTCGAGAAATATAGAAATATTGCCAGT
TATCAATCTTTATATTAAAGCTGATAGAACTGAATTTTTGTATTTTTATAGTTCTTTTAATAAGGTCTTC
GAGGAGTATGTATTAGCATTGACTCCTGAAGAGAGAAAAGGTAATGAGTTATATAATGAAAGAAAAGAAG
ATATAAGGAAAGTTAATGGGCTTAGAGAATTAGAAAATAAGGAAAATTTTACGATAGAATTTTATGAGAT
GGAGTTTATTGAAAGGTATGGCGAGTATACCTATATTGAAGAAAAAGAGCTTTATACAGAGTTCTTTTTT
TCAACTCAGCGTTTAATGGAAGATACTTTTTTATATCTCAGAAGTAAAGGGAAAGCTCTTGAAGTTCCTA
TGCTCATGTGTATGTTTTTAGTAGTTTCTCAGCAATTAGACAATACCGGTGTTGGAAGAGGATATCTTTC
TTTTAAATCGCATCTTTTAGGATTTTTGAATTATAAGAATAAAGATATCGAAAAGTACAAGATAATGTTT
GAAAAAAACTTTCAAGTACGAGAAAAGGTATTAGATCAATTGTGTAATGTAATACAAAATAAAACTTTAC
TTGAGGAAGCTGCTGAAAAAGATCCATTTCTTGAAATTGTGCTTAGATGGAACAATTACATGGAGGAGAT
GTATGATAAATTGTTGCCAATTCAAAAACTCCCAAGTAAAGTTTCGTATAAACAAGCTATACAAACTAAA
TTAGCGCATCGGAGATTTAGAAAGATGAGTTCTTTCCATAACAAAGTATTCTCTGAAAAAAATAGAGACT
TCTTTAAAGTTGATGAGTTCAGAGCTTATAGAATGCTTGTAAATTTTATATACCTAATCCTACCTAATAT
GGGCATGTCGTCTAGAAAAAGGGTAGAAGCTAGCTATATGTTAGTTGCAACTATGGAAAAGGAGTAA
 Primer design

Protein Sequence:348 a.a.
>Clocel_3633|ThioFinder631 Clostridium cellulovorans 743B
MYHNLKIYLNIESEKKNDFIAEKLIPFCREVIKKDYYFSRNIEILPVINLYIKADRTEFLYFYSSFNKVF
EEYVLALTPEERKGNELYNERKEDIRKVNGLRELENKENFTIEFYEMEFIERYGEYTYIEEKELYTEFFF
STQRLMEDTFLYLRSKGKALEVPMLMCMFLVVSQQLDNTGVGRGYLSFKSHLLGFLNYKNKDIEKYKIMF
EKNFQVREKVLDQLCNVIQNKTLLEEAAEKDPFLEIVLRWNNYMEEMYDKLLPIQKLPSKVSYKQAIQTK
LAHRRFRKMSSFHNKVFSEKNRDFFKVDEFRAYRMLVNFIYLILPNMGMSSRKRVEASYMLVATMEKE