Home 

Gene Symbol:  
HMPREF0059_01139
Organism:  
Actinomyces viscosus C505
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
409240..410502 [-1], 1263 bp
Product Function:  
PE-PGRS family protein
Product Locus:  
 ZP_08232035.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1263 bp
>HMPREF0059_01139|ThioFinder811 Actinomyces viscosus C505
GTGGCCCAAGAACCTGGGAGGCATGGCATGAGCACGCACGACGACGTCCAGTCCAGCCGGCGCGAGCAGC
GCAACCAGCCCAGCCGGCTCATCCGCTCCCGCAGGCTGCGCTGGCTCGGGGGGCGCTCGAGGGCCAGTGA
GCAGGCGGAGCGCACCGGGCCGGCGAGCCAGGTGGACCAGATGGGCCAGGTGGACCAGATGGGCCAGCCC
AGTCAGGGCGGTCAGGCCGGCCAGGCCGGAATGGTCGGCCTGGGGGGCGCGAAGCCGCAGGCTGGCGGCT
CGATCCCGGGGATCCAGCCCCTGGAGATGGCGGCCGCCGACTTCGGCAACCTGCGCGCCCAGCACAGCGC
GACGCGTCAGCGGAGCGCGGCGATGGCCGGTCAGCGTGAGGGTGTCGGCTGGCTGTATGCGCGGATCTAC
TGCGCCGGCGGGGACGACACCGACGCCCTGCTGCCCGAGGTCGCCCAGTGGCTGGATCGGGCCCGCGGCC
AGTGGGACATCCGCTCGGCGCACTTCCTGCGCTTCGTCGACCTGCGCGGCCACCACATCCGGCTACGGCT
CAAGGCCGTCGAGGGCGTCCTGGATGAGGCCTACGCGAGCATGCGCGAGCTGGGGGCCGTGGCCCAGCGC
ACCGAGGCGCGCACGGTCGAGCGTCTCGTCTCCGATCCGATGACCGGGGGGATCGGCGCGAGCCGGCCCG
GCATCACCTTCGGCGTCTACGGCCCCGAGTACGACAAGTACGGGGGAGTGGCCGGTGTCGAGGAGGCCGA
GCGGCACTTCTACGTCTCGAGCCGATGGTGCCTGGACCACCAGGTCTGGCAGATCCCGAGGCCGGTGCCG
CGGGCGGCCCTGGCCGCGCGGTTCCTGGCGCTGGCGGCCCGCAGTGCGCCACTGCCCGAGGCCGAGCTGC
TCTCCGCCCACCTGCGGATGTGGGGCTCGCGGCTCCCCGCGCACCTGCGCGACGGCAGCGCCCTGGGGCC
GATCGTTCAGCAGCTGCTCGAGGTCATCGAGTTCCAGTTCGACGAGATCCCGTCCTGGAGTCAGGCAGCG
GCGGCCGTGGGTGAGCTGGCCGACGATGCTGGGCGCGCCATCGGCGTCATGGGGGCGGGCACCGGCGGGC
GCCGGGCCCTGGACCTGCTGCACATCGACGTCAACCGGCTCGGCCTCAACCCGGCCGAGGAGTGCATCGC
CGGGCTGTGCGCCCGCCAGCTCCTGACCGGGGGCGCCGTGCCCCCGGCCCAGCCCTCAGCCGCCGTCGGG
TAG
 Primer design

Protein Sequence:420 a.a.
>HMPREF0059_01139|ThioFinder811 Actinomyces viscosus C505
MAQEPGRHGMSTHDDVQSSRREQRNQPSRLIRSRRLRWLGGRSRASEQAERTGPASQVDQMGQVDQMGQP
SQGGQAGQAGMVGLGGAKPQAGGSIPGIQPLEMAAADFGNLRAQHSATRQRSAAMAGQREGVGWLYARIY
CAGGDDTDALLPEVAQWLDRARGQWDIRSAHFLRFVDLRGHHIRLRLKAVEGVLDEAYASMRELGAVAQR
TEARTVERLVSDPMTGGIGASRPGITFGVYGPEYDKYGGVAGVEEAERHFYVSSRWCLDHQVWQIPRPVP
RAALAARFLALAARSAPLPEAELLSAHLRMWGSRLPAHLRDGSALGPIVQQLLEVIEFQFDEIPSWSQAA
AAVGELADDAGRAIGVMGAGTGGRRALDLLHIDVNRLGLNPAEECIAGLCARQLLTGGAVPPAQPSAAVG