Home 

Gene Symbol:  
HMPREF0059_01140
Organism:  
Actinomyces viscosus C505
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
410472..413891 [-1], 3420 bp
Product Function:  
basic proline-rich protein
Product Locus:  
 ZP_08232036.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:3420 bp
>HMPREF0059_01140|ThioFinder812 Actinomyces viscosus C505
TCATGCCATGCCTCCCAGGTTCTTGGGCCACTGGAGTCCCACCAGGTACTCGGCCACCGTCGGCTCACCG
TCCTGGGTGAGCCCCAGGGCCTCGCCGCGGGCCGGTAGGGCCTCGACGAAGCTGATGTGGGCGGCGCCGG
GGTCGATCCAGCCGCGCAGCGCCAGCAGTGACACCGGTGAGGTGAGGTCCACGTAGCGGGGCTTGTGCTG
GTCGAAGGTGGCGCCCTGGGAGGGCATGTGCTGGTGGACGAACACCTCCGTGGGTATGCCCCACTGCTTG
CGCAGGTCGTCCATGTGCAGCAGGGTCGTGGTCAGGTCGCGGTCCATGAGCGGGGCGATCTGGTGGGCCG
GGAAGGTCCAGGACTCGCGGCGGGTCACCAGGCGGCCGGCCACGGTCCGCTCGGAGTGCATCACCTCGTC
GGGCAGGGGCCCGTTCAGGTCCCGACGGCGGCTGGTCCAGTGGTCCGCGAAGGGGGGCAGCCGGGACCAG
GGGTCGCTCAGCAGCACCAGCCAGGACAGGTAGCCGCCCAGGAGGTACTGGGGGGTCAGGCCCAGGTAGG
CCAGTCCCACGGGCCCGGCGTCGTCCGCCAGGAACAGGGTGCTCGTGGCCGGGTCGTGGACGAGCCGCAG
GGAGCTGAGGGGGACCGCCTCCGGCGCCCCCGGCTCACCGGGCAGCCCCAGCGGCGGCAGGAGCCCGCAG
GAGACGGCCTGACCAGTGTTGCACTCGGTGCTGGCCTGGATCTCCAGGACCCGCTCGGTACCCCAGGAGG
TGCGGATCCGTGTGGCCAGGCGCTCCCGGAAGCCGGAGCCCAGGAGCCGGTGGAAGCGGGCCTGGAGGGA
GCCGTTGGCATTGGTGAAGGCGTTGACGACGGTCAGGCCCCCGCCGGCGGCGTAGGTCCGGGCGCTGGGG
GCCACCGGCTGGAGGAAGGCGCCCAGGTGCCTGGGCGAGCCGGAGAGCCCGCCGGACAGCGCGGCGCGCT
CCTCATTGGGGCCGGCGGCGTAGTCGAGCCCGGCGGCGCGCAGCATCTCCTGATCGCCGTCGGGGGCGTG
GGCGATGGTCATGAAGAAGGCCAGCGGGTCCTTGCACACCCCGCCGTTTCCGAACAGGGAGACGAAGCGG
GCCACCATGAGGTCGTAGATGTGGGAGCGGGCCACCCAGGGGTCGGCGAGCTCGCCCAGGGTCTTGACGT
CCTGCTCGAAGGGGGCGTCCTCGAGAGGGTCGACCCAGCTGCGGGTCGACTCGCGGTCCTCGTAGAGGAA
GCCGCTGGGGCGCTCGCCGAGCTCGCCGTCGGGGAAGACGCGCTCGGCCAGGCGCACCGTGCGGTTGAGG
AGCTCGGCGCGGCCGGGCCCGTCGGCGGCGCCGACGGCGTCGTCGAGCCGGGCCAGCCAGGCCAGGTCCT
TGCCCCACTGGCGCTGCTGCTCCGGTGAGAGCGAGGCGGCCAGCAGCGGGAAGGGGTTCTCCCCGCGGTA
CCAGGGCACGTGCGGCACGATGGCGCCGGAGGCCAGCATCCGCTCCAGGCGCAGGCGCGGGTCGGCGCCA
CCGACGCGCTCGCAGGCGTCGCGCACGCTGAGCACGGCGTGCATGCCGCCGCCGGTGAGGGCGTCGTGGG
TCTCCTGGAGCCAGCGGGCGGGCTGGATGGTCTCCTGGCGGAAGACCATGCCGTTGCCGTACTCGTGCTC
GCCGACGACGGTCAGCGCCTCCGCCTCGACCTCCCGGGAGGGGTACTGGCCGTAGGCGCCGGCCATGTCC
GGGCCGGGTGCGGCGCTGTAGGAGCGGCGCACGGGGGCGGGCTCGAGGTAGAGGGCGCCGTCGGCGGCCA
GGTCCTGGGCGGTGGCGCTCAGGATGCGGTAGGCCAGGTGGGTGGCCACCATGCGGTGGCTGCGCCCGCT
GGAGGGCTGGCCCGCCTCGTTGACGGTGGTCAGTCCTGAGAAGGGGCTGGTCTTGAGGGCGGCCCGGGTG
GCCAGGGTGTAGAGGGTGCGCAGGACGCGGGGGTCCTCGAGCCGGCGGCCGCGGGCGGCCAGGGTGGAGA
CCAGGGCCGGGGCGGCAATCGCCAGGGCCTCCTGGTAGCCGGGCTCGTCGAGGCCGGCCGCCAGCAGCTC
GCGGCTGCGGTCCAGGTCGACGTCGACCAGGACGGCCAGGCGGGCTCGGGTCTCCTCCTTGCGGGCCACC
AGGGCGTCCCAGCGCTCCAGCAGCGCGCGCAGCTCGGCGGGCAGGGCCGCCAGGACCTCCTCGGACAGGT
CGGTGGCGCGCCCCTGGAAGACGCAGCGCTTGGCGCGCAGGACCGGGCGGCGCTCGGCCTTGTCCAGGGT
GGGGACGATCTCGTAGAGCGGGTCGAGCAGCTGGTCGGCGGCGCCGTCGAGCACCTCGTCGAGCCGGCGC
AGGTAGTCCAGGGTGCCGATGACGGCGGCGCTGGTCTCGGGGACGGCCCGCACCGGCAGCCCGCCCAGGC
GCACGAGGGTCGGCAGGGCCACGGCGGGCTGGGCCAGGGCCGGGGGCTCCGGCTCCGGTGCCGGTACCGG
CGCTGGTACGGCGGAGGTCGGAGCGGATGGGATGGGCTCCCCGGGGGTCACGGCGGATACGGGCTGCGGC
TGTGGCTGTTGGGAGGGGGAGGCACCGGCACGAGAGAGAACCGGCTGCGTCATAGGAGGAAACCTTTCAA
GAGGGCGTACAGCCAGTAGCCTATCCATACAATGCTCATCACGAAGGCCACCAGTCCGAGAAGAGAGCAC
GCCAGCCCGTAGATGAAGTAGCCCCAGCGCACCGCGGGCCGCATGACGGCCAGGCCCGGCGGCAGCGGCT
GGCGCGTCAGGATGCAGCGCAGCACGAACATGGAGCGCCCGCGCAGGTTGACCGAGCCGGTGGCCGCCTC
GACCGCGGCGACGCCGTCGGACTGGGTGAGGGGGTTGAGGTTGGTGACGAGCATGGTGAGCTGGAAGGCG
CACAGGGTCAGGGCCACCTGGCGCACCGTTCCCGTCGAGGCCCAGGCGACGGCCGCCTCCAGTCCGCAGA
CGACGCCGTCGGAGAAGATGCCGGCCAGGGCCAGCATGGTCAGCCCGCTCCGGGAGCGCACCCGGTAGGA
GTCGGTACGGTCGACGTAGGCGATGGGGATCGCCCAGAACATGAGCGCCACCCCCAGTCCGCGGATGGGG
GTGCCCAGGTAGCCGGCGACGATGGCGTGCCAGGACTCGTGCAGCAGGATGCTCACCAGCTGGATCGCCA
CCGCCGTGACGAAGACCAGGACCCCCGGGCGGGGTCCCCCGGCCAAGGAGCTGAGCGCCATGGCCCCGGC
CGCGTACCCGCAGGCGGCCAGGGCCAGGAAGACCCAGCTGAGCGCGGGGGCCGGCAGGCGCTGGAGCAGG
GTGACGATCGGAGCGACGATCCGGTGGTACTTGCGGGCGATGATGATGCGGGGCAGCCAC
 Primer design

Protein Sequence:1139 a.a.
>HMPREF0059_01140|ThioFinder812 Actinomyces viscosus C505
MAAPHHHRPQVPPDRRSDRHPAPAPAGPRAQLGLPGPGRLRVRGRGHGAQLLGRGTPPGGPGLRHGGGDP
AGEHPAARVLARHRRRLPGHPHPRTGGGAHVLGDPHRLRRPYRLLPGALPERADHAGPGRHLLRRRRLRT
GGGRRLGLDGNGAPGGPDPVRLPAHHARHQPQPPHPVRRRRRGRGGHRLGQPARALHVRAALHPDAPAAA
AGPGRHAARGALGLLHLRAGVLSSRTGGLRDEHCMDRLLAVRPLERFPPMTQPVLSRAGASPSQQPQPQP
VSAVTPGEPIPSAPTSAVPAPVPAPEPEPPALAQPAVALPTLVRLGGLPVRAVPETSAAVIGTLDYLRRL
DEVLDGAADQLLDPLYEIVPTLDKAERRPVLRAKRCVFQGRATDLSEEVLAALPAELRALLERWDALVAR
KEETRARLAVLVDVDLDRSRELLAAGLDEPGYQEALAIAAPALVSTLAARGRRLEDPRVLRTLYTLATRA
ALKTSPFSGLTTVNEAGQPSSGRSHRMVATHLAYRILSATAQDLAADGALYLEPAPVRRSYSAAPGPDMA
GAYGQYPSREVEAEALTVVGEHEYGNGMVFRQETIQPARWLQETHDALTGGGMHAVLSVRDACERVGGAD
PRLRLERMLASGAIVPHVPWYRGENPFPLLAASLSPEQQRQWGKDLAWLARLDDAVGAADGPGRAELLNR
TVRLAERVFPDGELGERPSGFLYEDRESTRSWVDPLEDAPFEQDVKTLGELADPWVARSHIYDLMVARFV
SLFGNGGVCKDPLAFFMTIAHAPDGDQEMLRAAGLDYAAGPNEERAALSGGLSGSPRHLGAFLQPVAPSA
RTYAAGGGLTVVNAFTNANGSLQARFHRLLGSGFRERLATRIRTSWGTERVLEIQASTECNTGQAVSCGL
LPPLGLPGEPGAPEAVPLSSLRLVHDPATSTLFLADDAGPVGLAYLGLTPQYLLGGYLSWLVLLSDPWSR
LPPFADHWTSRRRDLNGPLPDEVMHSERTVAGRLVTRRESWTFPAHQIAPLMDRDLTTTLLHMDDLRKQW
GIPTEVFVHQHMPSQGATFDQHKPRYVDLTSPVSLLALRGWIDPGAAHISFVEALPARGEALGLTQDGEP
TVAEYLVGLQWPKNLGGMA