Home 

Gene Symbol:  
HMPREF0059_01142
Organism:  
Actinomyces viscosus C505
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
414855..415571 [-1], 717 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_08232038.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:717 bp
>HMPREF0059_01142|ThioFinder814 Actinomyces viscosus C505
CTGCGCGAGCTCATCTCCGGCTTCTCCGCCGGAACGGACACTCGCCCCGCCGAGCCGACCTCCGACGGCC
TGGCCGCGCGCCGCCCGCGCCCGCCGCTGGACTGCCGGCTGCCGGACGCGCTCGTCCCCGGCCCCCAGGA
CCCCTACCCCCACAGCCTGCACGAGACCTTCGAGCGCCGCTCGTCGTCGACCACCTACGGCACCGAGCCG
CTCGAGGCCGAGGCCCTCCTGGGCATGGTCCGCGACGCCCTGGTCGACGACGCACGCACCTGGGGGACGG
AGGCGGCGGCCTGCCCCCTGGAGCCCTTCGTGCTCCTGCTGCGCCCGGGCGGCACCGAGCCCGGCATCTA
CCGGGTGCGGCTCGACGGCGTCGACCTCGTCCGCCCCCTGCCGCCGGCCGAGGAGATCGAGGGCATGGCG
GTGCAGAAGGAGTTCGCCCGCGCCGGGGCCATCGTCTCGGTGGCCGCCAACCTCGATGAGGCCGACGCCT
GGGGCGGGGCCGCCGGCTACCGCTTCACCATGAGCCGCAGCGCCGCCCTCATCTACTCGCTGCACCTGCG
CGCCGCCGCTCGGGGACTGGTGGGAACGGTCTTCGCCGGCTTCGCCACCTCGGCGGTGCGCCACCTGCTG
GACTCCGACGGCGTCAGCCGCCACCAGATGTTCGCCGTCACCATCGCCAGCCCGCAGACAGAACCGCCAG
GTCAGGCGGCCGGCTAG
 Primer design

Protein Sequence:238 a.a.
>HMPREF0059_01142|ThioFinder814 Actinomyces viscosus C505
MRELISGFSAGTDTRPAEPTSDGLAARRPRPPLDCRLPDALVPGPQDPYPHSLHETFERRSSSTTYGTEP
LEAEALLGMVRDALVDDARTWGTEAAACPLEPFVLLLRPGGTEPGIYRVRLDGVDLVRPLPPAEEIEGMA
VQKEFARAGAIVSVAANLDEADAWGGAAGYRFTMSRSAALIYSLHLRAAARGLVGTVFAGFATSAVRHLL
DSDGVSRHQMFAVTIASPQTEPPGQAAG