Home 

Gene Symbol:  
HMPREF0059_01145
Organism:  
Actinomyces viscosus C505
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
418908..420290 [-1], 1383 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_08232041.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1383 bp
>HMPREF0059_01145|ThioFinder817 Actinomyces viscosus C505
GTGTACCGCTCTGCGCTCATTGAGGGCGTCGCGCCATCACTGGCTCGTGCTGCGTCACTCGAGTCTCCCT
TCGGCCTGGTTTCCCGTTCCACCGAGCTGCCCCAAGCGGCCGGAGAGCCGGTCTTCGCGATCTGGACCGG
TCTTCTGGGTGATCCCTCTGAGGCGCTGAGGTCACAGCGCACCTGGAATCACCGTGCCGAGGCGGGCAAC
TTCGACGGGGCCGGCGGGGCCATCGACGCCGATCGCGCCAGACACATCGCGATTGTGGAGACGATGGAGC
GCTACTCCAGCTGCTCATGGACGGAGGAGGAGCTGGTGTGGGACACCCCCGCCGGTCTCGGCGAGGCCGC
GATCGGACCGGTGCGCTGGCCGGCGTGCTCGGCCACCGAGCTGGCCGACCCCGACTGCGGGCTCATCGCC
TCAGACCCCCGCGTCCCCCTGCGATGGGTGCGCGGCTGGTCCCTGACCCGCGGCCGTGAGGTCTTCGTCC
CAGCGGTGCTGACGTACCTCAACTTCCCGGTGCGCACCCCCTCCGAGCAGTTCGTCAACCCCATCTCCAC
CGGCACCGCCGCCCACTCCGACCTGCGCGAGGCGGTCCTGGGTGGTCTGCTCGAGGTCATCGAGCGCGAC
TCCATCGCCCTGACCTGGCTCCAGCGCCTGCGCCTGCCCGCGGTCGCCGTCGACCCCTCCACCCTGGGGG
AGGAGGTCGCCGAGTACCACCGGGTCGGCACCTCCACCGAGCTGGAGACCCACCTGTTCGACGCCACCAC
CGACTACGGCGTCCCCACCCTCTATGCCGTCCAGACCTCCCAGGTCGACCCCGAGCTGGCTCAGGTGGTG
GCCGCCACCTGCGACATCGACCCGCAGCGGGCGCTGGCCAAGATCTACCGCGAGCTCGCCTCCCTGCGCA
TCGCCCTGCGCAGCCACGCCCGCGGCCCGCGCGCCCAGGAGATCAAGGGCCAGGACCTCACCGTCGTCGG
TGGCGCCCTGGCCGACGCCGAGCTGTCCATGCGCCACGTCTTCGACTTCCTCCTGGAGGGGGAGCGGCCC
GTCCACGCCCTCGATGAGATCGGCACCCTCACGGCGTCCAGGCCCGCAGCCGGTGGCAGTGCCGGCAGTG
CCGGCCCCGATCCGCTGGAGCAGGTCGTCGCCAACCTGGAGCGGGCCGGCGCTGAGGCCATCGTCGTCGA
CATCACCACCGACGAGGCCCGCCAGGTTGGCATGCACGTCATCAAGGCCCTCATCCCCGAGGCCATGCCC
CTGTCCTTCAGCCACCACGCCCGCTACCTGGCCACGCCCCGCCTCTACCAGGCACCCCGGGCGATGGGCC
TGACCGTCCACGACGAGGCGGGGATCAACCCCGTCCGCCAGCCCTTCGCCTAA
 Primer design

Protein Sequence:460 a.a.
>HMPREF0059_01145|ThioFinder817 Actinomyces viscosus C505
MYRSALIEGVAPSLARAASLESPFGLVSRSTELPQAAGEPVFAIWTGLLGDPSEALRSQRTWNHRAEAGN
FDGAGGAIDADRARHIAIVETMERYSSCSWTEEELVWDTPAGLGEAAIGPVRWPACSATELADPDCGLIA
SDPRVPLRWVRGWSLTRGREVFVPAVLTYLNFPVRTPSEQFVNPISTGTAAHSDLREAVLGGLLEVIERD
SIALTWLQRLRLPAVAVDPSTLGEEVAEYHRVGTSTELETHLFDATTDYGVPTLYAVQTSQVDPELAQVV
AATCDIDPQRALAKIYRELASLRIALRSHARGPRAQEIKGQDLTVVGGALADAELSMRHVFDFLLEGERP
VHALDEIGTLTASRPAAGGSAGSAGPDPLEQVVANLERAGAEAIVVDITTDEARQVGMHVIKALIPEAMP
LSFSHHARYLATPRLYQAPRAMGLTVHDEAGINPVRQPFA