Home 

Gene Symbol:  
bcere0015_51760
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5133767..5134738 [1], 972 bp
Product Function:  
similar to Lantibiotic biosynthesis protein of Bacillus cereus ATCC 14579 UniRef RepID=Q815Q2_BACCR
Product Locus:  
 ZP_04259698.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:972 bp
>bcere0015_51760|ThioFinder1093 Bacillus cereus BDRD-Cer4
ATGAACGAGAATAATTTTATATGGAAGGCTTATCATATTTTTTATCATCAAAATCAAGATTTTCTAATTA
CAAATTGTATCAAACCAATTTTAGATGAATTGATAAAAAAGAAATTAATTAGTAAATTTTTTTTTATAAG
ATATTGGGAAGGCGGACCTCATATTAGAGTGCGACTTTATTGTACATTAAATAAATCTCAAGAAGTTGAT
TATAAATTTAATGATTTTGTTTCTAAATTCTTGAAAACATATCCTTCTTCATCAACATTAGATAGAAACA
TGATAAAGAATCAATTAGCAAAATTAGCTAGTCTTGAAGAGGGTACTGAGTCAACATGTGTTCGAGAGAA
TAATCATATTATTCATCTAGAATATAATCCAGAGTATAAACGATATGGAGGAGAAAATGGAATAGAGATT
GCGGAAGAACATTTTTACCATTCAAGTATAATGTGTTTGAAGTTAATACAAGAAATTAATAAAAAGACAA
ATCGTTTGCGCATATCTATTGAAATTATACTATCTTATTTAAAAGCTATGAATATGAACTTACAAGAGAG
TATTAAGTTTTTAGAAGGCTATTATCTAATATGGAAAAGATATGTATACAGCAATACCAATAACGTTGAA
GAATTCTTCGCTAACAAATATATTAAGCAAAAAAAAGTAATAGACAAAATTGTAGTAAACTATTTCAATT
CTAATAATAATAAAGGTATGTTAGGAGAAAAATGGAGTAATCATTTGAATTTAACTGTACAGAATTTAGA
AAATGATTGGGATCGGGGAGAATTAATAATAGATAAAGATGTTTTAGCATATATAAATATCCCTCAAAAG
ATTGCTTTTATAGTTACAAGTTATGTTCATATGACAAACAATAGGCTTGGTATCATGCCGCAAGAAGAAG
CCTATTTAAGCTATATGCTTTTATGTAGTTTGAAATCATTGTATAAGAGTAGAAAGGGATGA
 Primer design

Protein Sequence:323 a.a.
>Bcere0015_51760|ThioFinder1093 Bacillus cereus BDRD-Cer4
MNENNFIWKAYHIFYHQNQDFLITNCIKPILDELIKKKLISKFFFIRYWEGGPHIRVRLYCTLNKSQEVD
YKFNDFVSKFLKTYPSSSTLDRNMIKNQLAKLASLEEGTESTCVRENNHIIHLEYNPEYKRYGGENGIEI
AEEHFYHSSIMCLKLIQEINKKTNRLRISIEIILSYLKAMNMNLQESIKFLEGYYLIWKRYVYSNTNNVE
EFFANKYIKQKKVIDKIVVNYFNSNNNKGMLGEKWSNHLNLTVQNLENDWDRGELIIDKDVLAYINIPQK
IAFIVTSYVHMTNNRLGIMPQEEAYLSYMLLCSLKSLYKSRKG