Home 

Gene Symbol:  
bcere0015_51750
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5131136..5133751 [1], 2616 bp
Product Function:  
similar to Lanthionine biosynthesis protein of Bacillus cereus ATCC 14579 UniRef RepID=Q815Q1_BACCR
Product Locus:  
 ZP_04259697.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2616 bp
>bcere0015_51750|ThioFinder1092 Bacillus cereus BDRD-Cer4
ATGAAACCAATAAACTATGTACCACATTTTTTATGTAGAATATCTGGTGAAGAAATAAACTCTATTTCAG
AAATTGAGTTTATTAAAACCTTGGAATGTTTAGAATTATCCGAAGGAATTTTAAGGAAAATAAATTCTTT
ATCAGCAGACTTAACGAAAGATTTACATGATTGTATTTCTTTATATAAAGAACAATCTATTTCACGTGTA
TTAATAAATCTTAAAAGAGATATTTTTAATATGAGGTTTAATCGAGTTCAAAAGTATAAACTAGAAAATA
TCTCAGGTTTTAACCACGATAAATTAAATTTATGGTTAAATTTAGCTCAAGAATATCAAAGCACGCTACA
TCTGATGAGAGAAACTTTTAAAATGGAAATACAGGAAAAAAGAGGGAAATTAAAGCAGTTATTTAGTAAT
AGTGAATATATAAAAGCCATTCAAGTCTCAAATACTCAACTTTATGAAAATCTCCTAGAATACTTACAAG
ATAATCAAAGTCATCCTCCAAAAAAGATGAGGAATATTGAACAGTCTCTAATTAATTACCTAAGTCGTAT
GATATTTAAGCCAACTCCCTTCAGTTCATTTACAGGATTAAATTACGGTTTTTTTAGTCAGGAAGATTCA
AGTTTTGAAATAAATACTAAGGAAAGCAAAGGTCACACTCGAATAAACATGGTTTATTTAAAAAAAATTG
AAAGAATGTTATTAAATCGAATATCTATAAAAAATAAATGTTATGTTTCGTTAAATCAAACGATAAACGA
AGAGGAAAATTATATGTTTTTTCGAAGAGGTAAAGATGGGACTAGTCAAGCTTTTACTGGTGAAGCTTTT
ATAAAGATAAAAAAGAGCGAGCTCTTAAAGGAGTTAATTCAATATTTTGAAGGAATATCTTCAATGAATA
TAGTTGAGGTTGTATCATTTCTTTCCGAAAAAACAAATTATGAAACTGAAGCTTTATATAATTACTTATT
TAAGTTAGAGAAAATGGGAGTGTTAGATTTTAGCTTAGGTGTGTCCGAACAATCGGACAATTACACGAAA
GATTTGATAGAAAACTTATTGGGGATTAAAGATTCATTAGTTGAAAAATCGGTCTCACACCTTGTAGAAA
TAGAAAAAATTCAGGCGATTTTCTCTGAATCCAATTACCAAAAACGTTATGTACTTTTAAAAAATTTACA
AGAACATATAAAGAAGATTTATAGTTTATTTGATTTAAAATTAGAGTCTAATGATTTGACCTCTCTATTA
TTCGAGGATGTTAGTTATAAAAATACTAAGATTATATTAAATGAAAATCAATGGAAAACGCATCTTGATG
ATTTTAATTTAATTAAGAATTTAATGCCACTTTTTGATGATAATATCCTTGAAAAATTAAGTATGAATAT
AATTTTTAAGGATATATATGGTAACAAGGGGGCAATAGATTTATTAGAATTCTATAGAGAGTTTAATAAA
TATGATAAAAATTTATTATGGAAGAAAATTAGAAAAAATGATACATATCTTTATTTAAAAAAATTGAGAA
CAGAGTTTTATGATTATCTAGAAACACAAATTAATATGGGGTTAGACACTATCTTTTTAAATAAAAGTTG
GTTAAAGAAATTTATTAACAAGTTCCCTGATTTATTGAAGAGTAAGGAAAATTATTCTTTCTATTTTCAA
ATAGCCTATGATAATCAAGATAATAGAATTTTAGTTTTAAATAAGATAGGGCCAGGATTAGGTAAGCACT
TTTCAAGATATGGTAATTTATTTTTAAATAGCGAATACAAGGAAAATAATAGATTTATTAATTCTCTTAT
AGAACAGTATAAAAAATATGATCAAAATGGGGGGGTTTTAACAGATTTAAATGCAGTGTTAGGTCTAAAT
CTTAATATGCATCCTAATCTTTTAAATTATGAAATTACTTATCCAGGATGCAATCCTAGTAAAGGAATTA
ATCAAGTAGCATTAAAGGATATTGAAGTATTGTATGATTCTAATTCTGACCAACTAAAATTATATTCTAA
ACAATATAGACAGAATGTTAAATTACTTCCATTGGGATTTTTGTTTCCAGCATTGTCCCCATCTTTATAT
AAGTTTTTATGTGGATTTTCGGAATCAAATGGGATAGAGTATTCTTTTTGGAACAAGTTCTTAAATGAAC
ACAATAATAATTTTTCACTTTTACCTAGAATTATGTTAGGATCAGTAGCTTTGGATAGAAGAACATGGAA
AATTAATGCGAAGGAAATACAAAAGGAATTTTCTAAAGATACATTTGAAACTTTTATTAACTTCCATAAG
TGGGTGAAAGAAAATCAACTACCGGAAGATATATTTTTAAGGGTTGCAAACACAATGGACGCTTTTAGTG
AGAATGAATTATTAAATCAAGATTTAGGAAGTTGGATTGCAGAAATTAAACAAACTAAACATCGTAAACC
TCAATATGTTAATTTTAATAATTACTTTCATATCGATGCCTTAAGAAAGATTATTAAAGATGTTAATAAT
ACAGTAACAATTCAAGAAGTTTATCCTCATCCAGATGATGTGTATTATCAAAAAAATAGTAAAAAATGTG
TAGAATTTTTAGTTGAGGTTTTTTAA
 Primer design

Protein Sequence:871 a.a.
>Bcere0015_51750|ThioFinder1092 Bacillus cereus BDRD-Cer4
MKPINYVPHFLCRISGEEINSISEIEFIKTLECLELSEGILRKINSLSADLTKDLHDCISLYKEQSISRV
LINLKRDIFNMRFNRVQKYKLENISGFNHDKLNLWLNLAQEYQSTLHLMRETFKMEIQEKRGKLKQLFSN
SEYIKAIQVSNTQLYENLLEYLQDNQSHPPKKMRNIEQSLINYLSRMIFKPTPFSSFTGLNYGFFSQEDS
SFEINTKESKGHTRINMVYLKKIERMLLNRISIKNKCYVSLNQTINEEENYMFFRRGKDGTSQAFTGEAF
IKIKKSELLKELIQYFEGISSMNIVEVVSFLSEKTNYETEALYNYLFKLEKMGVLDFSLGVSEQSDNYTK
DLIENLLGIKDSLVEKSVSHLVEIEKIQAIFSESNYQKRYVLLKNLQEHIKKIYSLFDLKLESNDLTSLL
FEDVSYKNTKIILNENQWKTHLDDFNLIKNLMPLFDDNILEKLSMNIIFKDIYGNKGAIDLLEFYREFNK
YDKNLLWKKIRKNDTYLYLKKLRTEFYDYLETQINMGLDTIFLNKSWLKKFINKFPDLLKSKENYSFYFQ
IAYDNQDNRILVLNKIGPGLGKHFSRYGNLFLNSEYKENNRFINSLIEQYKKYDQNGGVLTDLNAVLGLN
LNMHPNLLNYEITYPGCNPSKGINQVALKDIEVLYDSNSDQLKLYSKQYRQNVKLLPLGFLFPALSPSLY
KFLCGFSESNGIEYSFWNKFLNEHNNNFSLLPRIMLGSVALDRRTWKINAKEIQKEFSKDTFETFINFHK
WVKENQLPEDIFLRVANTMDAFSENELLNQDLGSWIAEIKQTKHRKPQYVNFNNYFHIDALRKIIKDVNN
TVTIQEVYPHPDDVYYQKNSKKCVEFLVEVF