Home 

Gene Symbol:  
bcere0015_51780
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5135737..5137263 [1], 1527 bp
Product Function:  
similar to NADH oxidase (NOXASE) of Bacillus cereus ATCC 14579 UniRef RepID=Q815Q4_BACCR
Product Locus:  
 ZP_04259700.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1527 bp
>bcere0015_51780|ThioFinder1095 Bacillus cereus BDRD-Cer4
TTGCAATATTCGCCTGCTAAAGCTTCAGATTTCAATTTAGATTTAAGTAATTATGATAGACCCTTGCCTT
TTAAAATTTATAGGAATAGAGAATCGATAGATTTAGACGATAACTTTCCGATTTGTATTAATGATTTAGA
TGGTATTGATTATTCAAATTTCGAAATTATTAGTTATTTATTGTGGTATACCTATGGTTTTACCAGCTAC
AATTGGTTAACAAAACCAACATTAAATGGTCAGAATACATCCTTAAGTTTTTTTAGAAGAAGTGTAGCCT
CAGGTGGCGGCTTATATCCTGGGGAAATTTACTTATATGTGGAGAGTATTAAAGGTATCAAGTCAGGATT
ATATTATTTTGATGTTAGGGGACCGAGATTAATTTTACTAAGGGAAGGAAATTTTCAAGAATTTATCAAA
AAATCTTTGCAATATAATCAAGATAGAAATGTTTATATTTTTATAACATCATTTTATTGGAAAAACTTCT
TTAAATATTTAAATTTCTCGTATCGTTTACAAGGCTTAGATATCGGTGCTATTGTAAGCCAAGCTCACCT
AATTTCAAAGAAATTAGGTCTTAATTCGGAGATTAGGTATCACTTTGATGATAAAAAAATTAATGATTTT
TTAGGAATCAACGCTGAGGAAGAAAGCAGCTACGTAGTTTTGCCTATAGATATGGATAATAATTCATATA
AAAGTGAAAATAAGGTTCCCGCTTTTGAGTACTTTAAAAACGATACAACATTCAATTATATTGAACATTT
AAATGTTGGCCCCAAAAATGTATGTCAGGATATTTATAAAATCAATAGTAATATTATCAATAGTGGCTTA
ATTAAAGTTAAAAAAAATGAAATAGCATCTTTTAAAGAGGAGGCAAATGTTGTTCATAAAGAAAAATATG
ATTATGACATTTTGAAGGCTTCTGTAAGTCGTATATCACCAGGAGAGAACTTTTTGTCTGATTTTTTGAA
TATTCAGCATGTTCACAAAGTTCTAGATGTTGGAATGCAGGAACAATTTAAAAATGATATTTTTAGCGAT
AATTATAGTGTTCTAAAGGATGTTGAAATTTACTTTTATGCCAATAAGATTGAAGGTTTACCAAAAGGCT
ACTATTACTATAATCCAAGTAATAAAAGTTTCGTTTTGAAACATAAAGGTGATTTTTCTAGTGTTTTTCA
GGAGAATCTTACACGAAAAAATTTTAATTTAGTAGAAATGCCTTTAATTGTGCACTTAGTATTAAACATG
AAAAAATTTATAGAAAATATGAAATTTAGAGGCTATAGAGTCATGCAAATGGAGGCAGGGAGAATTATGC
ATCAAATACAATTGAATGCTGCAGGTTTGAACCTAGGGAGCCATCCAATGTTAGGTTATAGGGCTGATAA
TTTGGAGGAGTTTTTTGGTATTCAAAATAATATAACTGTCCAGATGTCTATTGGTAAATATAGACCTTTA
TTGAGGCTAACCAATAATTTATTGAATAAAACTAAAGGAGAACAATTTTATGTATGA
 Primer design

Protein Sequence:508 a.a.
>Bcere0015_51780|ThioFinder1095 Bacillus cereus BDRD-Cer4
MQYSPAKASDFNLDLSNYDRPLPFKIYRNRESIDLDDNFPICINDLDGIDYSNFEIISYLLWYTYGFTSY
NWLTKPTLNGQNTSLSFFRRSVASGGGLYPGEIYLYVESIKGIKSGLYYFDVRGPRLILLREGNFQEFIK
KSLQYNQDRNVYIFITSFYWKNFFKYLNFSYRLQGLDIGAIVSQAHLISKKLGLNSEIRYHFDDKKINDF
LGINAEEESSYVVLPIDMDNNSYKSENKVPAFEYFKNDTTFNYIEHLNVGPKNVCQDIYKINSNIINSGL
IKVKKNEIASFKEEANVVHKEKYDYDILKASVSRISPGENFLSDFLNIQHVHKVLDVGMQEQFKNDIFSD
NYSVLKDVEIYFYANKIEGLPKGYYYYNPSNKSFVLKHKGDFSSVFQENLTRKNFNLVEMPLIVHLVLNM
KKFIENMKFRGYRVMQMEAGRIMHQIQLNAAGLNLGSHPMLGYRADNLEEFFGIQNNITVQMSIGKYRPL
LRLTNNLLNKTKGEQFYV