Home 

Gene Symbol:  
bcere0015_51740
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5129126..5131108 [1], 1983 bp
Product Function:  
similar to Hypothetical Cytosolic Protein of Bacillus cereus ATCC 14579 UniRef RepID=Q812K3_BACCR
Product Locus:  
 ZP_04259696.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1983 bp
>bcere0015_51740|ThioFinder1091 Bacillus cereus BDRD-Cer4
ATGAATAAGGAAGTCCTTATAATCAGGGATGAAAGCTTTGGAGAATTTTTTGATTCTTTTTTTTTAAATG
AAAATAATCGAAAAGTTTGTTTTATAGATAGTAATAAAAAAGATTTGAAATATTTATTAAAAAACTTTTT
AGAGAATAAAAAGTTTAGTTATGTACTAATCTTTCCAAAGGAATGGAATCCTATGATGTATAGGTCACTT
GATGCAGTGTTAGAAGACTATGATGTACCGTGGATCTATATAACACAATTTTTTAATAAAATTTTAATAG
GTCCTTTTAGAAATTCTAAGCAAAAAGGTTGTTTAGATTGTTTATATTATAGATGGTTTATGACAAAAAA
GGATCGTATTAATTTATTTGAATTGAAGAAATGTTTATCAGAAGGACATAATGTAAAAATATCTGGAGAT
TTATTGAATGCTTCAATGGTTGGATTAGCAATTACTTTAGCATTTAAACTAATAAATAATGAGGTTTCGG
AATTTTCGTATATTATTGACAAAAAGACATTGAGATTCAATGGTCATAATTTTTTACCTAATCCACATTG
TCAAGTATGTGGGCACATGGATAATGACGAGAAAAGATTAATAGAACACAAATTTTTTACAGCACTTAAC
GATAATACTCTTAAAGAAAAGAAAGGAAATCGTTTTTTATCAAAAGAATATTTAGAAGATACCCTATCTA
AAAATTTTTTAGATGTAGAAACTGGTATATTTAATAAACTTTTGGACGATTATGAAAGTCCTTTCGCAGT
TTCGGTAGCAAATCTTCCTTTAAAGGTTGGAAAGGATGAGGTTGGTGTTGGAAGAACGGATAATTATGCT
AATAGTCACTTAACTGCAATATTAGAAGGAATAGAGAGATATTGCGGAATGGAACCAAGGGGGAATAGAA
CTAACGTTTTTGGTAGTTATAATGAGCTAATGGAAAATGCTCTCAATCCATCTGTTTTAGGATTACACGC
GGAAGAACAGTATCAATTAAAAAGATTTCCTTTTAATAAATATAATCCAGATAAAAAAATGAAATGGGTC
TGGGGGTATTCTTTTAATAAGAATAAGGCGATATTAGTCCCTGAAACTTATGCCTATTATGGTACGAATT
ATAGAGATGGCGTTCAAAATAGTTTTGTTTATGAAATCTCGAATGGATGTGCTTTAGGAGGACATTTATT
GGAAGCTACATTGCAAGGAATTTATGAAGTAGTGGAAAGAGATGCTTTTCTTATATCTTGGTATACTAAA
TTACCATTAAAACGTATAAGAAAAGAATCTATTAAGGATCAGACGATTCAATTATTATTAACGAGATTTG
AATATCAAACTGATTATGATATTCATCTGTATAATATGACTTTAGAGAATAAAATACCAACTATTTTAGC
TATTGCAAAAAATAGAGGTGCTTTTGGCATGAATATTTTATGTGCTGCAGGTTGTCATTTAGATATAAAT
AAAGCAATTGAAAGTTCATTACATGAGTTATGTGGAATCTTAGAGGCAATCAAAAGTAAATTTGAAAATA
GGAAAAGTGAATTATACGAAATGGCAAAGAATTATTCACTTGTACGGACGATGGAAGATCATTCATTATT
ATTTGGATTGAAAGAACTTGAAAAAGAGTTTGATTTTCTATTAAAGAGCCCGATTGAAATTGATTTAAGT
GAGGTAGAACCTTTAAAATATAGCAACAATATACATACAGATTTATTGAATGTAATTGATTATTTTAAAA
AAATAAATTTAGATATCATCGTAGTCGATCAAACCGCGGAAGATATAAAATTTAACAACTTGTATTGTGT
AAAAGTTATTATTCCAGGAATGTTACCTATGACATTTGGACATGATATGAGAAGAATACATAATTTACCA
AGGATATTCCGTGTTCCAAGGGAATTAGGACATAAAATTAAGAATGAAAATGAAATTAAGAACAATCAGG
TAACTCCTCATCCTTTCCCATAA
 Primer design

Protein Sequence:660 a.a.
>Bcere0015_51740|ThioFinder1091 Bacillus cereus BDRD-Cer4
MNKEVLIIRDESFGEFFDSFFLNENNRKVCFIDSNKKDLKYLLKNFLENKKFSYVLIFPKEWNPMMYRSL
DAVLEDYDVPWIYITQFFNKILIGPFRNSKQKGCLDCLYYRWFMTKKDRINLFELKKCLSEGHNVKISGD
LLNASMVGLAITLAFKLINNEVSEFSYIIDKKTLRFNGHNFLPNPHCQVCGHMDNDEKRLIEHKFFTALN
DNTLKEKKGNRFLSKEYLEDTLSKNFLDVETGIFNKLLDDYESPFAVSVANLPLKVGKDEVGVGRTDNYA
NSHLTAILEGIERYCGMEPRGNRTNVFGSYNELMENALNPSVLGLHAEEQYQLKRFPFNKYNPDKKMKWV
WGYSFNKNKAILVPETYAYYGTNYRDGVQNSFVYEISNGCALGGHLLEATLQGIYEVVERDAFLISWYTK
LPLKRIRKESIKDQTIQLLLTRFEYQTDYDIHLYNMTLENKIPTILAIAKNRGAFGMNILCAAGCHLDIN
KAIESSLHELCGILEAIKSKFENRKSELYEMAKNYSLVRTMEDHSLLFGLKELEKEFDFLLKSPIEIDLS
EVEPLKYSNNIHTDLLNVIDYFKKINLDIIVVDQTAEDIKFNNLYCVKVIIPGMLPMTFGHDMRRIHNLP
RIFRVPRELGHKIKNENEIKNNQVTPHPFP