Home 

Gene Symbol:  
bcere0015_51720
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5127414..5128286 [1], 873 bp
Product Function:  
similar to Putative lantibiotic biosynthesis protein of Bacillus cereus ATCC 14579 UniRef RepID=Q815Q0_BACCR
Product Locus:  
 ZP_04259694.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:873 bp
>bcere0015_51720|ThioFinder1089 Bacillus cereus BDRD-Cer4
ATGTTTGTTCCCTTTATAGAAAGGAATGATCAAATGTTAGAAATAAAAGAAAAACAATTTATTAAATTAA
AAGAGGACACATTCTTTTTTCCTTCAGCTGAAGGGATATACTTTAGGAATTCTATAGGTTATTTTACAAT
CAAAGGTAGAAATATTTACCCGTTTTTTAGTGAAATCAGTAAATATTTGAATGGTAAATATACTTTGAAA
GATATAGTGAGTGAGTTAAGCAAAACCCAAGAAGAAAAATTTTTAAAATTAATTGCCATATTAGAGAAGA
ATGGTTTTGTAAAATATACCGAAAGGGTTATTGATGAAAATTATTATAAAAATTATGAAAAAGAAATTGC
ATTTATAGATTATTATACTAATAATGGCATCGAATTATTTAAAAAACTCTCTAATTTCAAGATTTGTTTA
TATGGTAGCAATAAGTTATCTAATACTATTCAAAAAAGCTTAGAAAACATAGGGATACAAAATATTAAAA
GAGGCTCTCGTTTTGATTTTGAGGGAGACATTGTTATTTATTGCAATAATGATGTTAATGAAAGGGAAAA
TCTACTGGAATGTATGGACTTTTCTCAGAATAAAATATTTATTTTTGTAGGTAATAAAGAATCATTAGGA
ATTATTAGTCCTATTATAAAAAATTTAGATGATTGGAAGGAATTTGAAAATATATTAGAGATTGGTGCAG
ATAATATTAAAGAAAATACAACATTTACTAGCAACTCTATATTAAGTAGTATGCTAAGTTTTGAAATTAT
AAAGTATGTAACAAATTGTTTGCAAAGTGATTTAATTAATGCGGCATACATTTTAAATACTGATACTTTA
AAAGGGAATTTTGTTCAGGTAAAAAAAAAATAG
 Primer design

Protein Sequence:290 a.a.
>Bcere0015_51720|ThioFinder1089 Bacillus cereus BDRD-Cer4
MFVPFIERNDQMLEIKEKQFIKLKEDTFFFPSAEGIYFRNSIGYFTIKGRNIYPFFSEISKYLNGKYTLK
DIVSELSKTQEEKFLKLIAILEKNGFVKYTERVIDENYYKNYEKEIAFIDYYTNNGIELFKKLSNFKICL
YGSNKLSNTIQKSLENIGIQNIKRGSRFDFEGDIVIYCNNDVNERENLLECMDFSQNKIFIFVGNKESLG
IISPIIKNLDDWKEFENILEIGADNIKENTTFTSNSILSSMLSFEIIKYVTNCLQSDLINAAYILNTDTL
KGNFVQVKKK