Home 

Gene Symbol:  
bcere0015_51770
Organism:  
Bacillus cereus BDRD-Cer4
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5134743..5135720 [1], 978 bp
Product Function:  
similar to Putative uncharacterized protein of Bacillus cereus ATCC 14579 UniRef RepID=Q815Q3_BACCR
Product Locus:  
 ZP_04259699.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:978 bp
>bcere0015_51770|ThioFinder1094 Bacillus cereus BDRD-Cer4
ATGGAGCAGTATCATAAAATTGTATTAACTGGAAGTAATGCTGAGACTATGTTAATAAAAAATATAGAGC
CTGTAGCAGTTAAGTTTATAAATAACTATAAGGGTTTTTTCTATGTTTTTAAATATAGTAAAGATTTTCC
AATTATCGATGTTTATATCAACAACAAAATTGTTACAGAAAATCAATTAAATAAAATTTTACAGAATTCT
GGGGCTAAATATAAAATTTATAAAAATTCAATATTTAATGAGACACAAGGGAATTTTGGGATGTTAGGTG
ATAAATATCTGGCAGAATTTTTTAAAAAGACAAATGAAATTAGCCTTAATATACTAAATCAAAATTTTGA
GAGTTACAATAAAAAAATAGAATTTGCGCTAGAGATAATGTTAATTTCAGCGCACTATAATTATGATTCA
ATAAAAAAAGGCTACTTATCCTATGCATCTCATGTAAATGGATTTTTTACTAGATGGAAAGATCCAAATA
AAATTAGAGATATATTTCATAAGAACTACTTAAATAACAAAGAGTACCTAGAATCGAAAGTTTCAGAAAT
AATAGATAATAACAACAGAAGTAGCTTGAGCGAATTATCGGATATTATTACAGAAATGAAGAAAGAGATG
ACTACTGATATTGAGAAGGGGAACCTGCATGTATTTAATATTGAATTACTACAAAAACCAGGAGAAAGAG
ATTTTCTAGAAAAAAGTCAGTTTCATAAGACGATATTAAATAATCCAGATTTCTCTAATTTTATGAATAA
AGATATAAACTTTTTAGGTTCACGCCTAATAACTGTATTTACGTACTTATTAATACGAAATTTAGGGATT
CAAAATAAAGATAGATATCTACTTTGCTACTATATCTATAAAATTATTGAAGAAAAATATAATATAGATA
CTTTGGAATTAATAAGGGATTTTGGTAAAGGGAGGGATAATAATGTTGAAGACTTACAAAGATATTGA
 Primer design

Protein Sequence:325 a.a.
>Bcere0015_51770|ThioFinder1094 Bacillus cereus BDRD-Cer4
MEQYHKIVLTGSNAETMLIKNIEPVAVKFINNYKGFFYVFKYSKDFPIIDVYINNKIVTENQLNKILQNS
GAKYKIYKNSIFNETQGNFGMLGDKYLAEFFKKTNEISLNILNQNFESYNKKIEFALEIMLISAHYNYDS
IKKGYLSYASHVNGFFTRWKDPNKIRDIFHKNYLNNKEYLESKVSEIIDNNNRSSLSELSDIITEMKKEM
TTDIEKGNLHVFNIELLQKPGERDFLEKSQFHKTILNNPDFSNFMNKDINFLGSRLITVFTYLLIRNLGI
QNKDRYLLCYYIYKIIEEKYNIDTLELIRDFGKGRDNNVEDLQRY