Home 

Gene Symbol:  
CpI19_1629
Organism:  
Corynebacterium pseudotuberculosis I19
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1776821..1777834 [1], 1014 bp
Product Function:  
Hypothetical protein
Product Locus:  
 ADO26885.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>CpI19_1629|ThioFinder1019 Corynebacterium pseudotuberculosis I19
ATGCGTACCACAGACCCCTGGCTGGCATTTCATATTTTTTATGGAGAAGACCCCTCTCACCTACTCCGCG
ACTGCTTATTACCTTTTGCTCATGCTTGCGTTGCAGAGGGGCTGGTAAGACGCTTCTTCCATATGAATTA
CTGGCTCGAAGGCGCTCATGTTCGCTTACGGTTAGAGCTGTCCAGCCCTGCGGATCGTGAGCGCGTCATA
TATAAAGCGCATCACGCTATCCAGCCATGGATCGATGCCCACCCTTCTAGTGCTCCCCAGTTGTCCTTGC
GTAATCCCGAAGGCTATCGGCGTCTTTTTGAACACGAATACCCTATGTCCAGGTTTTCTGATTACATCGA
TCAGGATGGCTTACCTCGCCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGCGAATATGAC
CGCTATGGCGGGCCAGCAGGGATGTCACTTAGCCAAGACATTTTTCAAGCCTCCACATTGTTCGTCGAAA
AGCTTTTGCGCTCTGGAGTTGTAGAAGCCCGCACCTCGCGTTTAGCCACAGCTGCTCTAGGAATGGTCTG
CACCGCGCATACCTTTTTATCCTCCGACGAGTCCATAAGTATCTTTTGGGAGAGCTACCACCGTGGCTGG
ACTTCCTCTTTTTCCATCCCCACCAGCTACACTTCCCCCGCTGCACAACAAAAAATCGCAGCCGAGGCTC
AGGCGCTCTCCCGCGCAGTCACGCCGTTCCGCGATGCATTACACCGCTATCCAGACGGTTCTTCCCTCCC
CGAACCTTATGCAACTTTTACTCGGCATATGGCCTCTGTTGTTGAGAAACTCCATGCTGCTCATGCTGCT
CAAGAGTTGGATTTTGGAGATTCTGTGGCGGAGGCTGGCCACACGTGGAAAGAAAATTCCACTTTTCTTC
TGCGTTCTTATGTGCATATGACCAACAACAGGATGTCCGTCAATATCTCGGATGAGGCATATCTGGCTTA
TTTATTACAGAAGTTATATCGGGAGACGCCATGA
 Primer design

Protein Sequence:337 a.a.
>CpI19_1629|ThioFinder1019 Corynebacterium pseudotuberculosis I19
MRTTDPWLAFHIFYGEDPSHLLRDCLLPFAHACVAEGLVRRFFHMNYWLEGAHVRLRLELSSPADRERVI
YKAHHAIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGPAGMSLSQDIFQASTLFVEKLLRSGVVEARTSRLATAALGMVCTAHTFLSSDESISIFWESYHRGW
TSSFSIPTSYTSPAAQQKIAAEAQALSRAVTPFRDALHRYPDGSSLPEPYATFTRHMASVVEKLHAAHAA
QELDFGDSVAEAGHTWKENSTFLLRSYVHMTNNRMSVNISDEAYLAYLLQKLYRETP