Home 

Gene Symbol:  
CpI19_1627(cltC)
Organism:  
Corynebacterium pseudotuberculosis I19
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1772743..1774221 [1], 1479 bp
Product Function:  
McbC-like_oxidoreductase
Product Locus:  
 ADO26883.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1479 bp
>CpI19_1627(cltC)|ThioFinder1017 Corynebacterium pseudotuberculosis I19
ATGGATCGCCGTACTGCAGACTTCTGGAACACAGCTGATAACACTGCTGCCGAATACACACAGCTTATTT
TGGAGCGCAAAGAATACGGCATGATCTCCCCAGCTCAAGGACCTTTTTGGAACCATCAGCCCTATCCAGT
AAAAGTGGTCCCCGATGCCCTGTGCTTCCCGGTTCGCGCACACACCATGTCTTCTACGGACCTTGCTATC
GCGCGCGCTATAGATGATTCCTTGTCCAGGACTCATTTACGCGCAGAAATCGACTGCAACTCTCCTACGC
GTACCCGAACTGAAGTGCAATCTTTTCAGTGGTCACGTAATACCGCTTCAGGCGGGGGTCTATATCCAAT
CAATCTCTATCGCTACACGCCCTGCGGTAGTCATCTGCCTGCTGGCCTGTATGTGCTCAATCCCATCACA
AGTCAATGGCAGCAGCTGATGAGTGGTGCCCTCCCACAAGACGTTTGGCCCTGCACTCATGGCGAGACAT
TGCTGGTTACCGTGGAATTCTGGCGTTCGGCGTTTAAGTACGGTGACTTTGCTTATCAAGCGACTTCGGT
GGACGTGGGGATCGTTGTCGCGGCATTAGTTTCCCGGCTCGATGCCACTGTGGGGTCGGTAGCTATTGAC
TGGTCCCCCGACGAACACAAGCTTTCAGATTTCCTCGGTATCGATCCTCTCGATGAGGGCATATATTGCA
CAATCACCCTGCCACGCGATATCTCTTCAGATTTTTTTGTTCCCTCAGTCGATTCCTCTACTGAGGTCTC
CCGCGCACACTCCGGAACAAAGCCTGTGCGCTTTCCCACCACTGTGGCTTTACAGAAACAACGGCTGGGG
GAAGCCCCCAATATACGCGTGCCTTTTTCTGCAAAAAGAACTCTGGCACCAACGCCGGTAGCCATCAGGC
GAGGTTCTAGTTCTTTTGGCCGTTATTCTGGGAAGGAAATCGGAGTTGATGTGCTCTCTCGTATGGTTCA
GCGCGGTCGTGCCACCGCTGATTCCCTCTTAGGTGTTTCACCGGAGTCCGATCTTTTTCCCTGTGTCCAT
GTAGCTGCGTTATGCGTCAATGTCCAAGGTTTATCCCATTCACTCATACCCGATGTTCGGACGCATACCC
CAGTATCTCCTGTACGCTTTTGCCCCCAGCTTCCTGAATTACTACTCAACACCTATCTGCTCAAGAACTA
TGATCCCCTGCGCAGCGCAGCAGTGTTGGTGTTGTGTGCGGATCTTCAGCAAATAGTCCTTGATTACGGG
GCTTCTGGCTATCGATGGGCTTGCGCTGAGATCGGGTTTTATTGTCAGTCGGCTTACGCTGTTGCGGCCC
AAGAACAGGTATCTGCGGGGGCGGTACTGGGCTTTGATGCTCGTTATCAACGCGATTACCTCGGTTTACC
GGATAATCTCATCCCGGTCCTCAACATTCTTGTGGGCGTGGATCGACCTCATGCTCAGTGGAGGAACTCG
TTACTATGA
 Primer design

Protein Sequence:492 a.a.
>CpI19_1627(cltC)|ThioFinder1017 Corynebacterium pseudotuberculosis I19
MDRRTADFWNTADNTAAEYTQLILERKEYGMISPAQGPFWNHQPYPVKVVPDALCFPVRAHTMSSTDLAI
ARAIDDSLSRTHLRAEIDCNSPTRTRTEVQSFQWSRNTASGGGLYPINLYRYTPCGSHLPAGLYVLNPIT
SQWQQLMSGALPQDVWPCTHGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSRLDATVGSVAID
WSPDEHKLSDFLGIDPLDEGIYCTITLPRDISSDFFVPSVDSSTEVSRAHSGTKPVRFPTTVALQKQRLG
EAPNIRVPFSAKRTLAPTPVAIRRGSSSFGRYSGKEIGVDVLSRMVQRGRATADSLLGVSPESDLFPCVH
VAALCVNVQGLSHSLIPDVRTHTPVSPVRFCPQLPELLLNTYLLKNYDPLRSAAVLVLCADLQQIVLDYG
ASGYRWACAEIGFYCQSAYAVAAQEQVSAGAVLGFDARYQRDYLGLPDNLIPVLNILVGVDRPHAQWRNS
LL