Home 

Gene Symbol:  
ORF
Organism:  
Streptococcus pneumoniae INV104
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
313763..314386 [1], 624 bp
Product Function:  
nosD
Product Locus:  
   [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:624 bp
>ORF|ThioFinder1379 Streptococcus pneumoniae INV104
ATGAAAAGAGATTGGAAATCAAAGCATTTATTTTATCATGATGTTCAACAATTTGATAAATTGGTAATCT
ATTTATCAAAATTTATGGATAAATTAGTTAATCAGAATCAGATTGAAAAATATTTCTATATTCGTTATTG
GGAAGGGGGGCCTCATATTCGATTAAGATATTTGGTGAGGGATACACAAAATTTTGAAACAATTGATAGT
ATGATAAATAAGTATGCTTATAAATTTTGGGAAAATAATCCTCCAATGAAGTTATTAAATAAGACCGATT
ATAAGAAAATTTATAATGAGAGTATTGATAACAACGGAAAGATGGATAGAAAATTGAGGAAAAATGCGAC
TATTGAAAACATTGCCTATATACCGGAAATAGAGAGATATGGCGGGGAAGAAGCTCTGATAGTAAGCGAA
GATCTATTTTGTATCTGTAGTCAGGTTTCAACTGCGTTACTTAATGTGGTAGATAACTATTACCCAAATT
TCAAGTTGAAGTTAGCCACCCAAAAGAAATTCACTTGGCGACTTGTAGTCCAAGCATTTTTTAGGGTAGT
TGTTAATCCAATTTTCGATAAAAGCTACTTCTTTCGGAGTCGTTTTCTTGGTTCCTTTAGGTAA
 Primer design

Protein Sequence:207 a.a.
>ORF|ThioFinder1379 Streptococcus pneumoniae INV104
MKRDWKSKHLFYHDVQQFDKLVIYLSKFMDKLVNQNQIEKYFYIRYWEGGPHIRLRYLVRDTQNFETIDS
MINKYAYKFWENNPPMKLLNKTDYKKIYNESIDNNGKMDRKLRKNATIENIAYIPEIERYGGEEALIVSE
DLFCICSQVSTALLNVVDNYYPNFKLKLATQKKFTWRLVVQAFFRVVVNPIFDKSYFFRSRFLGSFR