Home 

Gene Symbol:  
INV104_02840
Organism:  
Streptococcus pneumoniae INV104
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
308767..309786 [1], 1020 bp
Product Function:  
Lantibiotic biosynthesis protein
Product Locus:  
 CBW35968.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1020 bp
>INV104_02840|ThioFinder1043 Streptococcus pneumoniae INV104
ATGTCAAATACATTGAAGCAATTACTACTTTTTAGAGAGGAGTTCATAAAAAATATTTTGAATGGGATTG
ATGTGGATGAAACAGTAGTAATAGAAAATGATTTTGTAGAAGAGTTGGAGAACTTTTTAAAAGAGAATGA
TTTGCTAGATTTTTCAAATAGCATATTTTTTCAGTTATCTGGAGATAAAGTAATAGTGAATAATATTTAT
CCAGGATATTTAGCATATTTTAATAGGTTCCTTACATTTTATCCGAAAATATTCGCTATTAAAGAAGTTG
GAGAATATATTGACTTTTTAAATTTTGAAAAGAGAATTGCGGATATGTTTTATTGTTGGGGATTTAATGC
AAATTCTAGAGTGTTGACAGCTGAAAAAATAATTGAAATCCCAAATCACCAAATCAATGCTAAGTACATA
AAAAAAGTTATAAAAATGAGTGAACTCTTGTTTGGTGTTGATAGTAATAACAGAATTCGGTTGCTTAACA
ATAGAAGGGAATTGATAAAAACTATTTTCCAAGGTTCTGTAATTAAGTCAGCAATTCCTGCTCTAGCTGC
TACTTTGGATACAATCAGTAACAGTGGATCATTTCAAATTTCTTTATCAAAGCAGATAATTAATAATTTA
GTATTAAGTGGTAAAGATAAAGTTACAATTCCTAGGATAGAGTTAGATAATGTTGTTCTTTCAAGACAGA
AGATTATTGTATCAGTTTCGTATATAAATGATTTTTTGGATTTGAGATTTCCAGATAAAATAGAATACAT
TTTAAATTTTTTAGAAGGATCTGGTTTCAATACTAAAGTAATGGTCTACTTTGGGAAAATTGTAGAAGAA
GATAAGAACTATTTTGTTAATCTTGAAAAACCTCAGTATTTTGATTTTACCAGTATACTTTTCAATAAGT
TATTCTTTAAAGAATTAAACAAGTTTGATTACATGGTTATTGAAGAACTCATTCCAAATCTTGATGAAGA
TGTAATGATGACAGAGTATATAAAAGAGTATACTGAATAG
 Primer design

Protein Sequence:339 a.a.
>INV104_02840|ThioFinder1043 Streptococcus pneumoniae INV104
MSNTLKQLLLFREEFIKNILNGIDVDETVVIENDFVEELENFLKENDLLDFSNSIFFQLSGDKVIVNNIY
PGYLAYFNRFLTFYPKIFAIKEVGEYIDFLNFEKRIADMFYCWGFNANSRVLTAEKIIEIPNHQINAKYI
KKVIKMSELLFGVDSNNRIRLLNNRRELIKTIFQGSVIKSAIPALAATLDTISNSGSFQISLSKQIINNL
VLSGKDKVTIPRIELDNVVLSRQKIIVSVSYINDFLDLRFPDKIEYILNFLEGSGFNTKVMVYFGKIVEE
DKNYFVNLEKPQYFDFTSILFNKLFFKELNKFDYMVIEELIPNLDEDVMMTEYIKEYTE