Home 

Gene Symbol:  
INV104_02890
Organism:  
Streptococcus pneumoniae INV104
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
315888..316658 [1], 771 bp
Product Function:  
unnamed protein product; Raw score 2.93
Product Locus:  
 CBW35973.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:771 bp
>INV104_02890|ThioFinder1048 Streptococcus pneumoniae INV104
ATGGAAAAATATTTTTTTGATATTTCTATTTTTGAAAAAATAAAAAAAGTATTATCATACCAATCTAAAT
ATTGGGAAATATCGAAGCCTAGGGATAAGTACAGTTTCAAAAGTCAAAATAGAATATCTGGCTCTAATAG
CATTAAATTTAAAGATTTTGAGTTAGATTATGAACTGGAGTCACTTGGTAAAATACTTTTAAAAAGGAGA
TCGTTTTTACTAAATGAATTTGATAAGAATGCGAGTTTTGACAAACTGATTTACTTGTTGAAAACTGTAT
TCTCTCCTACAAATTGCAAGTTTGTATTTGGAGAAGAGGTTCCTTTATTTAGCTATCCTACATCAGGTGC
GTTAAATTCAATTACTCCTTTTGTTTATATTGATAATATGGATGAAGTAAAGAATGGTATATATGAAGTA
AAGTATGACGGACTTGAATTTAAAAAAAGTATGAATATTATAGACTTAGAAACATTTACCCCAATAACAA
GTAAAAACAGTGACGTACAAAATAATTCATTTAAAAAGGTAAATATGATAATTATGTTATGTTCGAATTA
TGAAAATATTTTCAATAAATATGGATTATTAGCTTATCGACTTTTGCATTTAGAGGCTGGTCATATTGCA
CAAAATATCCAGCTTGTTTCTACTGCGCTAGGAATAAAAAGTTTACCGATGGGAGGTTGGTTTGATGATA
AAATAGAAACTTTTATTAATGAAATTAGTGATAAAAAAAATATTTATCTCTATGCAATTGCAGTTGGATA
A
 Primer design

Protein Sequence:256 a.a.
>INV104_02890|ThioFinder1048 Streptococcus pneumoniae INV104
MEKYFFDISIFEKIKKVLSYQSKYWEISKPRDKYSFKSQNRISGSNSIKFKDFELDYELESLGKILLKRR
SFLLNEFDKNASFDKLIYLLKTVFSPTNCKFVFGEEVPLFSYPTSGALNSITPFVYIDNMDEVKNGIYEV
KYDGLEFKKSMNIIDLETFTPITSKNSDVQNNSFKKVNMIIMLCSNYENIFNKYGLLAYRLLHLEAGHIA
QNIQLVSTALGIKSLPMGGWFDDKIETFINEISDKKNIYLYAIAVG