Home 

Gene Symbol:  
INV104_02870
Organism:  
Streptococcus pneumoniae INV104
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
311841..313739 [1], 1899 bp
Product Function:  
unnamed protein product; Raw score 2.97
Product Locus:  
 CBW35971.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1899 bp
>INV104_02870|ThioFinder1046 Streptococcus pneumoniae INV104
ATGAGAATAATTGAAATTGTTGATGTTGAGGACCAACTTTTACAACTTTTAAGTGCACATACCAATATTG
ATATTAGAGCACAAGAGTTATCAACACTTGACCCAGATTCAAAAGTTGATTTGATCATATACTTGAAATC
TCGACGTGATATTGAAAACATAAATAATATTATTATTAAATCACCTAACAGGAATATCATTGTTATAATA
AGTGCTTTTGATATTATATATGCATTGTATTTTCCAAAATCAACATTTAGACCTTGTTTGAACTGTCTAT
TATTAAAACTTAAAGATAACAACCCTGAGCATAATCTATTATTATTCCTGAAATACGGAACATTACCTAG
TAAACATTTTAATCTTGATAATAGGTTAAAATCAAATTTAATACTATTTAATGAGAAGTTAGACCCTAAG
GTAGAGGAGTATAGTATTGAGGGGGTAAATACTACAAATTTTACTTTCCATTTTAGTTGTAGCTGTGAAA
ATAGTGGTTACGATATGTCGGAAAGAATGGCAGATATTCTACTTGGTGAAGGAAAAAAATTATCTCCTAA
AAATTATCGTTTAAAAAAGAGTGAGCATCTATTCGATTTTACTAGATATCTAGATAGAAATTTTGGATTT
TTTCATCATTCATATGATGAAAAAATCTCCGAATATGCGCCTCTCCATGCAGTAGAGATTAATGTTGATG
CTGGTTACGAGTCAGGCTGGGGAAGGACTTTTATGACAGAGGCTGCAACAAAATCTGCTTTTTTAGAGTC
ATTAGAGAGATACTGCAACTCTAGAAATAGACGCTATAAAAAATTAATTAGAGGGTGTTTTTCTGATTTA
TCTAAAAAGTACAATACATTAAATCCTGTTGATTTTTGTCTTTCTAATAAAGAATATAGAGATAGTTCCT
ATAAATTTCATGATTTTGATTCTGAGAAAAATTATGATTGGATATTTGGTAAAAATATAACTACCGGAAA
AATTTGCTTATTGCCCTCGCAACTAGTATTTTATAAAGACTTTAGTAAAAGCGAAGAAAATGAAAGGTTT
GTTTATGAAACATCAAATGGATGTGCTTTGGGGAGTAGTATTGAGGAAGCTATTTTTTATGGGATTTTAG
AGATTATTGAAAGAGATAATTTTTTACTTACATGGTATTTAAAAGAAGAAGTAAAACAATTATCATGGGA
ATCTTTACCATCTCGCCTACGTATTATTAATGAAAGACTAAAAGAAGATAACTGTGAGCTCAAACTTTTT
AATATAACTAAAGAAGTGGGCATACCAGTAATTTGGGCATTGTATATAAATCATAATGAAAATGCTAGTA
TTCGAAGTTTTTCAGCTGCAGGCTGTCATATTAATCCTTTAAGTGCAATTGAATCAGCAATTTTTGAAGT
AATAACTTCTGTGCCAACTTTTGAAAGATTAATTGAAGTTAGAAATAAAGAGTCATTTATTGAGGAAATT
CAGAATAATTTTTCTTTAATACGAGATATTGACGATCATATATTGTATCATGCTCATGCGGATTATAAAA
ATAAAATGCCCTTTTTATTTAAAAATAATTATAGTGAATATCAAAATGAATTTGATGAGAATAGAATTTT
TAATACTTATTCACATGCAACGCTTACATCAGATTTACAGGCACTAATAAAAATTATTGAAAAAAAATTT
GGAGATATATATGTAGTGAATATAAGTGATAAAGTTTCCGAAAAATTTGGACTTTATTGTGTTAAAGTGT
TGATTCCTGGACTTCTTAATATGTCATTTGGACATTCAAATCGGCGTGTAAATATAGAGAGGATAAAAAA
TTATGTAGATTATAGAGGGGGAAATGTAAATAGTATTACATTGAATTCCATAAACCATCTTCCCCATCCA
TTTCCATAA
 Primer design

Protein Sequence:632 a.a.
>INV104_02870|ThioFinder1046 Streptococcus pneumoniae INV104
MRIIEIVDVEDQLLQLLSAHTNIDIRAQELSTLDPDSKVDLIIYLKSRRDIENINNIIIKSPNRNIIVII
SAFDIIYALYFPKSTFRPCLNCLLLKLKDNNPEHNLLLFLKYGTLPSKHFNLDNRLKSNLILFNEKLDPK
VEEYSIEGVNTTNFTFHFSCSCENSGYDMSERMADILLGEGKKLSPKNYRLKKSEHLFDFTRYLDRNFGF
FHHSYDEKISEYAPLHAVEINVDAGYESGWGRTFMTEAATKSAFLESLERYCNSRNRRYKKLIRGCFSDL
SKKYNTLNPVDFCLSNKEYRDSSYKFHDFDSEKNYDWIFGKNITTGKICLLPSQLVFYKDFSKSEENERF
VYETSNGCALGSSIEEAIFYGILEIIERDNFLLTWYLKEEVKQLSWESLPSRLRIINERLKEDNCELKLF
NITKEVGIPVIWALYINHNENASIRSFSAAGCHINPLSAIESAIFEVITSVPTFERLIEVRNKESFIEEI
QNNFSLIRDIDDHILYHAHADYKNKMPFLFKNNYSEYQNEFDENRIFNTYSHATLTSDLQALIKIIEKKF
GDIYVVNISDKVSEKFGLYCVKVLIPGLLNMSFGHSNRRVNIERIKNYVDYRGGNVNSITLNSINHLPHP
FP