Home 

Gene Symbol:  
INV104_02850
Organism:  
Streptococcus pneumoniae INV104
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
309799..310902 [1], 1104 bp
Product Function:  
unnamed protein product; Raw score 2.95
Product Locus:  
 CBW35969.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1104 bp
>INV104_02850|ThioFinder1044 Streptococcus pneumoniae INV104
ATGATTTTAAGTAAAGTACGTTGTTACATATATAATTCTAAAATTAGAGGTAAAGTTCTGTATGAATTAT
ATGAATTTATAAATGAAAATAAGCAATTGATGGACGCAATTAATTCAATTAAAGTTGACAGTAGTAATGG
TTTTAGTATTCAAATATTACATTTAGGAGAACAGCAAACAACTGTCTTATTAACAGATTTTTTTACTAAA
ACTTTAGACTTGTTTAAGGAATTTAGGGTTACAAATAAGAGTACTCTTGAGCAGGTGAAAAATCAAATTA
GCATACTAAATTCTTCTGGTCCAAAAATGGATTTAACGAATATAAAAACAGATTACTCAATAGTGGAAGA
AAAATTAGATTGGCAAAGTAAATTATCTAAAATTTATCCGAATGTTGAATTTATAAAAATTGAAAAATTA
AAATTGATTTTGTTGTGTAAATATAGAAATCAAATTATTGACTTAGAGGATGATAAAAAAAGATTGTTAC
TATTGAAATTATTATATTTGACTTCAAAGCAATTTTGCTATGATGAATTTAAAGGAGCGAAATTTGGATG
TATGTCATTTTTTTCACATTATCAAGGTTATATGAGCAGATTAGATTCACTCGACTCAGATAAATTTGTT
TCGGTTAAACAGAGGATTGTTTCCTCTATTTCTAAATTAGTTGAGCAATATTCAGATCATATTATAAATC
TGGATAGAACTTTAGTTGATTCTCTAAGTGATACCCTTGAGAATCAGCTATTTGATGATTGGGATTATAT
ATTAAGCGAAATAACTACATATAGCGAATTATTAGCAAAATCAGGATTGTTATATAATTCGCTAGACTAT
AAGATTGATAATGTAAAAAAAGAAGTGGCCAAGCTAAGTGACTTTCACCAATCTTTATTTAAAATTGAAG
GATTTTCAGATTTTTTTGATAGTTGGCAATTTCAAAGATATAGGTCTCTCGTGAACCAAGTTTATGAAAT
TTTTTCAATGTTACAAGTAAGTAGTGTAGAAAGAACTGTGTTGTGCGGAGCTCTAAGTACTATTGTCTTT
AGTAAGTCAAATTTTAACTATCAAGCTTTTTTTGAGTATCTAAAAGATACGTAG
 Primer design

Protein Sequence:367 a.a.
>INV104_02850|ThioFinder1044 Streptococcus pneumoniae INV104
MILSKVRCYIYNSKIRGKVLYELYEFINENKQLMDAINSIKVDSSNGFSIQILHLGEQQTTVLLTDFFTK
TLDLFKEFRVTNKSTLEQVKNQISILNSSGPKMDLTNIKTDYSIVEEKLDWQSKLSKIYPNVEFIKIEKL
KLILLCKYRNQIIDLEDDKKRLLLLKLLYLTSKQFCYDEFKGAKFGCMSFFSHYQGYMSRLDSLDSDKFV
SVKQRIVSSISKLVEQYSDHIINLDRTLVDSLSDTLENQLFDDWDYILSEITTYSELLAKSGLLYNSLDY
KIDNVKKEVAKLSDFHQSLFKIEGFSDFFDSWQFQRYRSLVNQVYEIFSMLQVSSVERTVLCGALSTIVF
SKSNFNYQAFFEYLKDT