Home 

Gene Symbol:  
tsrD
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12175..13215 [1], 1041 bp
Product Function:  
similar to lantibiotic biosynthesis protein
Product Locus:  
 ACN52294.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1041 bp
>tsrD|ThioFinder1150 Streptomyces laurentii ATCC 31255
GTGAGCACCGCCCCGGCACACCCCTGGCTGTCCTGTCATGTCTTCCACCACGGCGACACCGATCCGCTGA
TCGCGGAGTGCCTGCTCCCCCTGGTCGACGACCTGCGCCGGGCGGGACGCGTGGAACGCCACTTCTATCT
GCGGCACTGGGAACGCGGCCCGCACGTCCGGCTCCGGATGCGGGTGCCGGCGGAGCACCACGACGCGGTA
CGCGCGGAGACCGAGCGGCGCGTCCTCGACTACCTCGGGCGGCGCCCCGGCCCCGTCGACACCGATCCGG
CACGGCTGCGGGACGCGCTGCGCCGGCTCAGCGAACTGGAGCACGGCGACGCCTCCGATGTCGCCGTGCG
CACCCCGGAGCCGCCCAACTCCCTTCGCTGGATCGACTATCAGCCCGAGCTGGCCAAGTACGGCGGGCCC
GAAGGCGTGGCGATCGCGGAGGACGTCTTCCACGCCGGCTCGGTGCTGACCGGCCAGGTCCTCCGGCTGG
TCGACAACGACCGCGCCCGGATGGGCATCGCGCTCCAGCTGCTGCTGCTCGCCTCGCGCGCGCTGGGCTT
CGGTCCCGACGAACGCGCCGTCTTCCTCCGTACCTACCAGGAACGCTGGTCCGGATACGTCACGGACCCC
CGCGTCCTCGCCTCCTGGGACCGGCAGTACCAGCTGCAGCGGGAGCAGTACGCGGCCCTGCTCGACGGCC
TCGACGCCGGCGACCCCGTCGGGAAGGGGCTCGGCGCGTACTGGGAACGGACCCTCGTCCAGGCCCTGGA
GCGGCTGCGCCCGCTCGTCGGGACGGGCCGGGTGTGGCCGGCGGAGACCGACCCCGCGGCACCGCCGGTG
GTCGCGCTCGCGGCCCTCGTCAGCCAGTTCCTGCACACCACCAACAACCGGATGAACGTCCGCCCGCAAG
GCGAGTGCTTCGTCGCCTACCTGGCCTCGCGCGCGGCCGAGGACCAGCGCGCCGCCCGGTCCGGCACCGC
CCCGACGGCCGACCCCGCCCAGACGGCACACGAGAGGGATGAGCGTCATGTCCACCAGTGA
 Primer design

Protein Sequence:346 a.a.
>TsrD|ThioFinder1150 Streptomyces laurentii ATCC 31255
MSTAPAHPWLSCHVFHHGDTDPLIAECLLPLVDDLRRAGRVERHFYLRHWERGPHVRLRMRVPAEHHDAV
RAETERRVLDYLGRRPGPVDTDPARLRDALRRLSELEHGDASDVAVRTPEPPNSLRWIDYQPELAKYGGP
EGVAIAEDVFHAGSVLTGQVLRLVDNDRARMGIALQLLLLASRALGFGPDERAVFLRTYQERWSGYVTDP
RVLASWDRQYQLQREQYAALLDGLDAGDPVGKGLGAYWERTLVQALERLRPLVGTGRVWPAETDPAAPPV
VALAALVSQFLHTTNNRMNVRPQGECFVAYLASRAAEDQRAARSGTAPTADPAQTAHERDERHVHQ