Home 

Gene Symbol:  
tsrC
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9377..12178 [1], 2802 bp
Product Function:  
putative lantibiotic dehydratase
Product Locus:  
 ACN52293.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2802 bp
>tsrC|ThioFinder1149 Streptomyces laurentii ATCC 31255
ATGGATAGTCCGGAGATCACGTACGCCGGATACGGCGTCGTCCGCGTCTGTTCCCAACCCGCCGACATCA
TCGCCCAGTTGTCCTCGCGCGAGGCCGCCCGCGTCTGCGACGAGCTCAGGGACGTACGGCGTACCTGGCA
GGACCTCGCCCCCCGGGTCGCCGAGGAACTCACCGAGGTGGTCCCCCTCCTCACCGACCGGGACGAGCGG
CGGACCGTTCTCGCGCTGCGCCGCCGGCTGCACCGCGCCGCGGACGTCCCGGCCGCCGACCTCGACGTCC
TGAACCTCGCGTACGGAACCTCGGCGGACGGGCCCGGGGCGGCCGGGACCGCGGTGGCCGGGCCCCTGGC
GCCCGGGGCCGCCGCGCTGCGGGCCCTCGCCGAGCGCCGCGACGACCTCGCGGCCCGCCTGGAGGGCGCG
TACGAGGAAGGGCTGAACGCGGAACGGAAGGTGCTCGCCTCCGCCGCCCTCGACCCCGCCCTGCGTGCCG
GAGCCCAGCTGAGCGCGGACGGTCTGCTGCGCAACATGGACCGCTACGCCGCCGCCGTCGCCGAGGGCAC
CGCCCCCGGCAAGCGGGAGCGGATGACCGAGTCCACCGTCCTCCATCTGCTGACCCGCAGCACCCTCAAG
CCTTCCCCCTTCGGGCAGTTGGTGCACACCCGGCCGGTCCTCCTGCCGAAGCGCGCGACGGACGCCACGC
CCGTCATCGCTCCCGTCACCGCTCCCGGCACGGACGAGGCGGCCGAGCGGCCGGTTTCCGTCTGCCGGCT
CCCCCGCCAGCTCGTGAGCTGGGTGGAGCGTTCCCTCGCCGGCCGGCCCGCCTTCCGGCATGTCGCCGTC
CTGCGCCGCGCACCGGTCGTCGGCTCCTCGAAGGAGGGTGTCGTCTTCCTGCTGCGGGGCCGGGACGGCA
CCCACGAGCCGGCCGCCAAGGAACGGTTCGTCCGCGTCCCGCCCGGCGTGGTGGTCACGGCGGTCCTGGC
CCTCGCGGCGGACGCCGCCGTACCCGAGCGGGAGCTGCGGGAACGGTGCGCCGCCCTGCCCGGCACGGAC
CCTGCCGCCGCCGGTGCCGCCCTCGACGCGCTGATCGGCCAGGGCGTCCTCGCCCGCGACCTGGGCGTCG
GCGACCAGCACCCGCACCCCCTCGCCCGCCTGGCCGCCCTCCTCCCCCCGGACTGCGACGCCGGCCTGCG
CGCGGCCGTCAGCGGGCTGGCCGGCGCCGAGTCCGCGTTCGAGACCGCCGGCCTCGAACGGCGCGAGGAA
CTCGTCTCCCGTATCAAGGAGCACGTGGCCCGGGTCGCCGAACTCACCGGCGTCGCCACCCCGCCGATCG
ACGTCGCCCGCACCCTCGTCTACGAGGACGCGGTCGTGGCCGTCCCGCGCGCCGAGGCGCCCGGCCGGTG
GGGGCGGCATCTGCCCGCGCTGGCCCCGTGGCACCGGCTGCTGCCGCTCTTCGACGACGCCGCGCACGTC
CGGGCGATCGTCGCCGACGTGGTCAGGACCCACTTCGGGCCCGGGCCGCACCGGCTCCTTCCCCTGTTCG
CGGCGCTGTCCTCGGCCAAGGTGCAGGCCGTCCTCACCGAGCGGCTCACCGACGTGTCGGCGCCGCTGCC
GACCCGGTTGCGCACCCTTCAGGACGCGGTGTTCGCGCTCGCCGATCCCGACGGCGGCGCGGACACGGTG
ACGGTCGACCCGGAGCGGGCCGCGCGGCTCGCCGACGACCTGCCGTCCTGGATCCCGCGCTGGTCCCGCG
CGAGCTGGCACGTCCAGCACCACGCCGCCCCCGACGGCGGTCTGCTCGTCGTGAACGGCGGATCGATCGG
CTTCGGCCGCGCGATCTCCCGCTTCCTGCCCGCCTACGCCGCCGCCGGGGACGCCGGTTTCGGCGACCTG
GTCACGGCCGAGATCGCCCGGGACGACGACCCGTCCGCGCCCCTCACGGACCTCGCGGCCGTGCTCGGCA
TCAACGCCAACGTGCACTCCCCGCTGCTCGGCCGGCACCTCCGCTACCCCTGCGCGACCCCGGAGGAGTG
GGGCGGGAACACCGGCGTCTCCCTGGAGGACTGCTGGGTCGTGTACGACGCGGACACGGGCCGGCTGCTG
CCGCGCCTGGGCAAGGACGGTCCCGTCCTGCGGCTGGTCATGCTGAACTTCCTGCTCAACGAACTCGCCC
CGCGTTTCTACCAGTTCCTCAACTTCTTCAGCTCGGGCAGCCTCGCCAACCTCGCCTGGTGGGACCGGGT
CGACCAGCGCCGCGAAGCCGGTGCCGGTGCCGACGGTGGTGCCGGTGCCGACGGTGGTGCCGGTGCCGGT
GGTGGTGCCGGCTCGGGTACGGACTCCGTACGCCACTACCCGCGGGTCCGCTCCGGCAGCCTCGTCCTGG
CCCGCCGCACCTGGAAGGTCCCCGACGCCCGGCTCCCCGGCCTCGCCGGCGCGACCGGTGTCGCGGCCTT
CGCGGAGGTACGGCGCTGGCAGGAGTCGCTGGGCCTCCCCGACCAGGTCTTCTACCGCGGCTTCACCCTC
CCCGACCCGCTCGTCCCGATGTCCCGGGAGGAGCAGCGGACCTGGGCGAGGACCCTCGCCCGGTTCCCCA
CCTCCGCCGAACGCAAGCCCACCTTCCTGGACTTCACCAGCGTCACCAGCGTGACCGCCTGGCAGCGGGC
GCTGCGCCGGTGCCAGGGCGGCCTGACCTTCCAGGAGTGCCTGCCCGCCGTGGGCGAGGACGAAGGGGCG
GCGGGCGGCCTCCGGGAGCGGTTCACCGAGGAATTCATCGTCGAGACCACCGAGACCGAGGAGGAAGGGT
GA
 Primer design

Protein Sequence:933 a.a.
>TsrC|ThioFinder1149 Streptomyces laurentii ATCC 31255
MDSPEITYAGYGVVRVCSQPADIIAQLSSREAARVCDELRDVRRTWQDLAPRVAEELTEVVPLLTDRDER
RTVLALRRRLHRAADVPAADLDVLNLAYGTSADGPGAAGTAVAGPLAPGAAALRALAERRDDLAARLEGA
YEEGLNAERKVLASAALDPALRAGAQLSADGLLRNMDRYAAAVAEGTAPGKRERMTESTVLHLLTRSTLK
PSPFGQLVHTRPVLLPKRATDATPVIAPVTAPGTDEAAERPVSVCRLPRQLVSWVERSLAGRPAFRHVAV
LRRAPVVGSSKEGVVFLLRGRDGTHEPAAKERFVRVPPGVVVTAVLALAADAAVPERELRERCAALPGTD
PAAAGAALDALIGQGVLARDLGVGDQHPHPLARLAALLPPDCDAGLRAAVSGLAGAESAFETAGLERREE
LVSRIKEHVARVAELTGVATPPIDVARTLVYEDAVVAVPRAEAPGRWGRHLPALAPWHRLLPLFDDAAHV
RAIVADVVRTHFGPGPHRLLPLFAALSSAKVQAVLTERLTDVSAPLPTRLRTLQDAVFALADPDGGADTV
TVDPERAARLADDLPSWIPRWSRASWHVQHHAAPDGGLLVVNGGSIGFGRAISRFLPAYAAAGDAGFGDL
VTAEIARDDDPSAPLTDLAAVLGINANVHSPLLGRHLRYPCATPEEWGGNTGVSLEDCWVVYDADTGRLL
PRLGKDGPVLRLVMLNFLLNELAPRFYQFLNFFSSGSLANLAWWDRVDQRREAGAGADGGAGADGGAGAG
GGAGSGTDSVRHYPRVRSGSLVLARRTWKVPDARLPGLAGATGVAAFAEVRRWQESLGLPDQVFYRGFTL
PDPLVPMSREEQRTWARTLARFPTSAERKPTFLDFTSVTSVTAWQRALRRCQGGLTFQECLPAVGEDEGA
AGGLRERFTEEFIVETTETEEEG