Home 

Gene Symbol:  
tsrF
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
14305..16074 [1], 1770 bp
Product Function:  
McbC-like protein
Product Locus:  
 ACN52296.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1770 bp
>tsrF|ThioFinder1152 Streptomyces laurentii ATCC 31255
ATGACGGCCCCGGGGACCGCCGAGGCCACCGCTCCGGTCGAGGCCGCCGCCCCCGCCGAGGCCGCCGGAA
CCGGGCCCTTCGACGCCGCCGGAGTGGACGGCTTCGTCCGCCGGCTCCGGGGCGACTTCGACGAAGTCCA
CCCGGACCAGTGGCAGATCGACTGGCGCAGCATCCCCAGCCCCTTCCGCTGGTACGTCGACCTGCCCCGG
CGCGATCTGCCCGCGCTGTCGCGCGCGGCCGCGGCCGGCGGGCCCGCCGCGGCGGCCGCGTTCGCCGCGG
CCGGGCCGCTCGGCCGGCTCGGCATGCTGCTCCAGGGCGCCTACGGACTGACCGGCGTGCGGTGGTACCC
CGAGGGCATCGCCAAGAGCAGCCCCGCCGAGCCCACCCCCGTCCACCGCAACCCGCACTACCAGCTGCGC
CGCGCAGTGCCCTCGGGAGGCGTGACGTACCCCGCCGAGTGCTACGTCGTCACGGCGGGCACGGCGGGCA
CGGAGGGCACGGAGGAAGAGGACGGTCTCGACGCCGGGGTGTACCACTACGACGCGGTACGCCACGCACT
GGCCGTGCTGTCCGCCGGCCGGCCGCCTGCGGAGCTGACGCCGCCGGAGGGCGGTGTCCGGATCGTCGTC
ACCCAGCCGCTGTGGAAGAACTACTTCAAGTACGGCGACTTCTCCTACCGGCTCGGCGCCATGGACACCG
GTGCCGTCGTCGGCCAGTTCGCGCTCGCCGCCCGGTCCTGGGAACTGCGCTGCCGGGTGACGTTCGGGGT
GGACGAGCGGCGGATCGCGGACCTGCTCGGGCTCGATCCGGAACACGAGGCCGTCCCGGCCGTGCTGGAC
GTCTCCCTGGGAGACCCGGTGGGACCGGCGGCATCCGCGGCCGAGACCGCGCCCCCGGTCGGGCGGCCCC
GCTGGCTGGGCGAGTCCGTCCCGCCCGGCCCCGCCACCGGCACCCGCCGGATGCACGCCGCGTGCCTGGC
CGCCGGCCGCCCCGGCCGGCCCGTCGACCTCCCGCCGGTCGTCCTGCCCGACCTGGCCGGGCAGGCGGAC
GTGGAGCTGCCCCGGCCGGCCGGGCGGCCGGTGTCGGTCGCGGACACCTGGTCCCGGTCGGCGCTCGGCG
AGCAGTTCCGGGGCACGCCGCTGCCCGCCGAGGTCCTGGCGGACTGGCTGACCACGGTGCTGGCCCCGCT
GGACTGCGACGTCACCGGAGAGCAAGCCGGCCGCGCCGACACCGACACCGGAGAGCGGGCCGGCCGCCCC
GGCACCGGGACCGTCACCGGCGAGGCCGCCCCGACGCACGCCCGCTGCCTGCTGATCGCGCGGTCCGTGC
CCGGCGTGCCTCCGGGCGCCTATCTGCCACACCCGGACGGGCGCCGGCTCACCCGGCTCGCCGCCGGGGA
CTTCGGGCCCGAGGTCCAGCGCAGCATGTTCGCCGACTACATGAACGTCGGGCAGGCGCCGCTGACCGCC
GTCATGATCGGCGCCGCCGATCCGCATCGCGGTCCGGCCGGCCCGATCGGCTACCGCACCCAGCATCTCC
TCGCGGGCGTCCTCGCCCAGCGTCTCGCCGCGTGCGCGGCGCGCGACGGCAGATCGGCGCACCCGGTGCT
CGGCTTCGTCAGCGGCGTCCTCGACGACGCGTTCGGGCTGCGGGCCCGGGGCCTGACGTCCCTGCTCCTC
GTCCCCGTGGGCGGTTACCGCCGGGGCCTCTATCTCGAGAACAGTCTGAGTCCGCTCGCCACGCGGGCGG
GCGACGGGAGTGGAATATGA
 Primer design

Protein Sequence:589 a.a.
>TsrF|ThioFinder1152 Streptomyces laurentii ATCC 31255
MTAPGTAEATAPVEAAAPAEAAGTGPFDAAGVDGFVRRLRGDFDEVHPDQWQIDWRSIPSPFRWYVDLPR
RDLPALSRAAAAGGPAAAAAFAAAGPLGRLGMLLQGAYGLTGVRWYPEGIAKSSPAEPTPVHRNPHYQLR
RAVPSGGVTYPAECYVVTAGTAGTEGTEEEDGLDAGVYHYDAVRHALAVLSAGRPPAELTPPEGGVRIVV
TQPLWKNYFKYGDFSYRLGAMDTGAVVGQFALAARSWELRCRVTFGVDERRIADLLGLDPEHEAVPAVLD
VSLGDPVGPAASAAETAPPVGRPRWLGESVPPGPATGTRRMHAACLAAGRPGRPVDLPPVVLPDLAGQAD
VELPRPAGRPVSVADTWSRSALGEQFRGTPLPAEVLADWLTTVLAPLDCDVTGEQAGRADTDTGERAGRP
GTGTVTGEAAPTHARCLLIARSVPGVPPGAYLPHPDGRRLTRLAAGDFGPEVQRSMFADYMNVGQAPLTA
VMIGAADPHRGPAGPIGYRTQHLLAGVLAQRLAACAARDGRSAHPVLGFVSGVLDDAFGLRARGLTSLLL
VPVGGYRRGLYLENSLSPLATRAGDGSGI