Home 

Gene Symbol:  
tsrG
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
16071..17909 [1], 1839 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACN52297.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1839 bp
>tsrG|ThioFinder1153 Streptomyces laurentii ATCC 31255
ATGACAGCGCCGACCGACACGACGACCGGGACGAGCGAGGCGGCCGGGACCAGCGAGGCGGCCGGAACGA
GCGACGCGACCGGGACGAGCGACGCGACCGGGACGAGCGACGCGACCGGCACCGTTCTGCGGCTGCGCGC
CGACGCCTACTACGTACCCGTGCCGAACGGGGTGTGGATCCGGACGACGGACGGCTCGTTCACCCTCAAC
GGCAAGGCGGTCGCGACCTGGGTCGAGCGGCTCGCGCCCCTCCTGGACGAGGGGGTGGTACCCGCCCGGC
TCCTCGGGGCGCTCCGGCCCGAGCAGGCCGGGTTCGTGGAACAGCTCCTGACCCTGCTGGAGAAGCGGGG
AGTGGTACGCCGGGAGGCCGCCGCCGACGGATTCGGCCCGGACCTGGCCCGGCTCTTCCCCCAACAGGCC
GCGTTCCTCGGCCACTTCGCCTCGCGGCCCGCCGAGGCGTTCGACCGCGTACGGCGGCACCGGGTGGCGG
TCGCGGGACCCGCAGGACGCGCGGACGTCCTCGTCACGACGCTCATGGAGGCCGGGTTCGGCGACTTCGC
CCTCCTGGACGCCGAGCCGAGCACCGAACTCCGGGACCTGGCCGCCGACTTCGAGCGGCGCGGCGCACCC
GTACGCCTGTCCGGGCCGGACGGTGATCCCCACGACCGCACGCTCATCGGGGTGTTCGACCCCGGGACGG
ACGGCGAGGCCGACGCCCGGCGGTTCCTCGACCGGGCCGGCGCGCTCGGCGGCGGCGCCTGGGCGGGCCT
GGTCAGCGGCCAGGCGATGCTCCTCAAGGGACAGGTGCCGGGCTCCGGCCGGGCCTGCGTACGGTGTGCC
TGGCGGCGGCTGGCCCACAAGGCCGTCGCGCTGCCGCACTCCGACACGCTGGGCCATGTACCGGTGTCGA
TGGCGGCGACCGTGCTCGCCCAGGAGCTGTTCCAGTACGTCGCCGGGGCCGACGACTCCGTACTCGGCGA
GGGCGTCGTGGTGGACCTGACCCGGCTCAGCGTCTGGCGTACGGACGTCGACCCGGACCCGGACTGCCCG
GCCTGCTCCGCGGCCCGCCCGTCCGGCGTACCGGCGCCGGCGCACCGCCGGACGTCCGCGTACCCCGACG
CCGTCTTCGGCGCCCGCTGCTTCGGCCCGCTGTTCTCGTGCACCCCCGAGGAACTGCCCCAGTTCCCGCT
CACCGCGCTGCGGGTGCGGGTCAACCCGCCGGGGCGCACCGCGCCGACGGGGGCGCTCGACGGCCCGGTC
GTCGTGGCGCGGTCCATGGTCGACGCGCGCGCCGAGGCGGCCCTGACCGCCGTCGAGGCGACGCTCCCCG
CGGCGGACGAGGCAGCCGTCGCGGGCGTGGGCCGGGACCACGCCGAGGCGCTGGCGCGCGCCCTGCTCCG
GTGGGCCGACCGGACGCCGGAGGACGCCCGCGCGGAAGGCGGCAGGGAACCCGTCCGCACCGAGGGGACG
GGCACGGCGCCCGCCCTCGCGGAGCTGGCCGCCCTCGCCGACACGGACGTCGCCGTCGGCGTCACGCACC
TGCCGAGCGGCTTGTGGCGGGCCCGGGCCGACGACGGCACGGGTGCCGTCGTCCGGACCGGGTTCGACCC
CGACCAGGCGGCGGAGCGCGCGCTGACCGCCCTGCTGGCCCGCCGGCAGCTGGGACCGCGGCCCGATGGA
GCACCGGTCGTGGCGGCGTGGCCGGGCCCGGTCCCGTCCCGGGAGCGGGTCGGCGAGGTCGCGTCCGCGC
TCGGCCTGACCTGGCGCGAGGCCGTCCTGCCGCCGCTGGTCGCCGCCGATCTGACCGCGATCGTCCTGAC
CGGGGAGTCCACCGGATGA
 Primer design

Protein Sequence:612 a.a.
>TsrG|ThioFinder1153 Streptomyces laurentii ATCC 31255
MTAPTDTTTGTSEAAGTSEAAGTSDATGTSDATGTSDATGTVLRLRADAYYVPVPNGVWIRTTDGSFTLN
GKAVATWVERLAPLLDEGVVPARLLGALRPEQAGFVEQLLTLLEKRGVVRREAAADGFGPDLARLFPQQA
AFLGHFASRPAEAFDRVRRHRVAVAGPAGRADVLVTTLMEAGFGDFALLDAEPSTELRDLAADFERRGAP
VRLSGPDGDPHDRTLIGVFDPGTDGEADARRFLDRAGALGGGAWAGLVSGQAMLLKGQVPGSGRACVRCA
WRRLAHKAVALPHSDTLGHVPVSMAATVLAQELFQYVAGADDSVLGEGVVVDLTRLSVWRTDVDPDPDCP
ACSAARPSGVPAPAHRRTSAYPDAVFGARCFGPLFSCTPEELPQFPLTALRVRVNPPGRTAPTGALDGPV
VVARSMVDARAEAALTAVEATLPAADEAAVAGVGRDHAEALARALLRWADRTPEDARAEGGREPVRTEGT
GTAPALAELAALADTDVAVGVTHLPSGLWRARADDGTGAVVRTGFDPDQAAERALTALLARRQLGPRPDG
APVVAAWPGPVPSRERVGEVASALGLTWREAVLPPLVAADLTAIVLTGESTG