Home 

Gene Symbol:  
tsrE
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
13202..14308 [1], 1107 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACN52295.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1107 bp
>tsrE|ThioFinder1151 Streptomyces laurentii ATCC 31255
ATGTCCACCAGTGAACAGAAGGATCTCACCGTCAGCGTCCCGTGGTCGGTGCAGGAGGACCTCCTTCTCG
ACGTGGCCGCGCCCCTGCTCGACGAGTCGGTGGAACTCGGGGAGACGGACTCGTGGTTCTACCTCCGCGA
GAACCACGGCGGGCGGCCGTTCCTGCGGCTGCGCTTCGCGAGCCGCAGCCCGTCGGTCGAACGCCGCCTG
AAATCACGGATCCTGGCGCACGTCGGGCCGACGATCGACGCCGGCGACGTCTTCACGTACCAGCCGTACA
ACCACGAACACGACTGGCTGGGCGGCACCGCCGGGCTCGGGCTCGCCGAGAACTTCTGGACCGAGACCAC
CCCGCTGGCGCTGGACACCCTGCGCGCCACCCGCGGCAACCGGGCCCTGCGGCTCGCCGTGGCCTTCGAC
TTCCTCGTGTGCACCGGCGTCATGCTCGCGCCCCATCTGCCGCCGTCCATCGCCAAGTTCGGCTACAAGG
CCGGCTATCTCTCCTACCTGGCCACGTTCGAGGGCTACATGCTGCTGATCCGGGACCCCGAGGGCACCCG
GGCCAAGCACGCCCAACGGTACGAGAAGAACCGGGAGTTGCTGCGGCCACGCCTTCGCACGCTCGTCGAG
CAGATGAGCGAGCCGGACGGCGAGCTGACCGACGTGCCCGAGCTGGCCCGCGAGTGGCTGGTCCGGCTGC
GCGACTACGTCCCCGCCCTCCAGAAGGGCTTCGACGAGGGCCGCTTCTACCTCTACGCCACGCCGCGCAA
GGCCGAGACGGCCAAGCTCACGCCGTCGCCCGACGGCCTCTACCGCAGGCCCGACGTGGAGTGGCTGTCC
GACCTGCCGGAGCCCCCGGTGGCCGGCATCCACCGGGCGATCGCCGACAACACGTACTACCAGGGCATGA
TCCGCGAGGACCGCCGCTTCCTGGCCTCGCGGCTGGCGCAGGCGTACACCAACTGGCATCTGTACCGGCT
GGGCTTCCTGCTCGCCGACCGGTACACGCTCTTCTACCTGATCGCCCGCGCCTTCGAGGAGGAGTACGAC
CTCGACGCGGCGGCGCTGATCCGGTCGGTACGGCCGGAAGCAGAGGTCGCCGGATGA
 Primer design

Protein Sequence:368 a.a.
>TsrE|ThioFinder1151 Streptomyces laurentii ATCC 31255
MSTSEQKDLTVSVPWSVQEDLLLDVAAPLLDESVELGETDSWFYLRENHGGRPFLRLRFASRSPSVERRL
KSRILAHVGPTIDAGDVFTYQPYNHEHDWLGGTAGLGLAENFWTETTPLALDTLRATRGNRALRLAVAFD
FLVCTGVMLAPHLPPSIAKFGYKAGYLSYLATFEGYMLLIRDPEGTRAKHAQRYEKNRELLRPRLRTLVE
QMSEPDGELTDVPELAREWLVRLRDYVPALQKGFDEGRFYLYATPRKAETAKLTPSPDGLYRRPDVEWLS
DLPEPPVAGIHRAIADNTYYQGMIREDRRFLASRLAQAYTNWHLYRLGFLLADRYTLFYLIARAFEEEYD
LDAAALIRSVRPEAEVAG