Home 

Gene Symbol:  
BATR1942_14070
Organism:  
Bacillus atrophaeus 1942
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2760699..2761586 [-1], 888 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003974667.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:888 bp
>BATR1942_14070|ThioFinder1172 Bacillus atrophaeus 1942
ATGAAAGAATGGGTGTTTTACAGCATTTATGTGCCGAGGGCCGAGTATTTAGAAAAGATTATCGTCAACA
TTGTGACACCTGCTGTTCAGCAAATCAAAAACAGTGTTCAAGTACATAAGTGGTTTTTTATCCGTTATAT
TGATATGCAAGGCCCTCATATCCGTTTGAGATTTTTGGTGGATGAGGCTGAGATGGAAGCCGCTGAAGAG
CTCCTTGAAGAGCGTTTCAGCCAATGCCTTTCGGCGGTCATAGCCGAACCGGTTCCAGACTTAAGCCGTT
TGCTGCCTGTCAAAGCAGAGACAGCGGATTTTGAATCTGGATTTCAGCAGGAAGAATATGAACAGGAGTA
CGAAAAATACGGCGGCCTTCAAGGAGTGGATGTTGCTGAAAATATCTTTCAGTCGTCGAGTGAACTTGCT
CTTTTATTTGTGAATCATGATTATTTTTCCGATAAAGACCGCTTTGATCTGGCGCTGTTATTAATGAAAA
TAACTGCTGAAAAAGCCTCTCTGTCAGAAGCGGAAACGCGGCAGCTTTGGGAAAGCATGCTGCATTACTG
GAGCGGAGCTGATTACACGGAAGGGATTTCCTATAAAACAAAACTGGAAGAGGCTGCGAAAAAAAGGGTC
GATGTCATCAATCAAGTGATGGAAAGGATGGCCGCCGATCCGCGTGTCAAGGAATTAACGGACGGTTATG
GACAAGTGCTTGAACATGCCTTTTCTGAGATAAAAGAGTCTGAGAAAATCAGAACCCCGGTTTCCCACTT
GGCTTTCCACTATATTCATATGATGAATAATCGTTTAGGAGTCTGGCCGATAGAAGAGGCATATCTTGGC
GCTTTGCTGGCGCATACGTCAGGATACGTTCCAGAGGCAAAATCATAA
 Primer design

Protein Sequence:295 a.a.
>BATR1942_14070|ThioFinder1172 Bacillus atrophaeus 1942
MKEWVFYSIYVPRAEYLEKIIVNIVTPAVQQIKNSVQVHKWFFIRYIDMQGPHIRLRFLVDEAEMEAAEE
LLEERFSQCLSAVIAEPVPDLSRLLPVKAETADFESGFQQEEYEQEYEKYGGLQGVDVAENIFQSSSELA
LLFVNHDYFSDKDRFDLALLLMKITAEKASLSEAETRQLWESMLHYWSGADYTEGISYKTKLEEAAKKRV
DVINQVMERMAADPRVKELTDGYGQVLEHAFSEIKESEKIRTPVSHLAFHYIHMMNNRLGVWPIEEAYLG
ALLAHTSGYVPEAKS