Home 

Gene Symbol:  
BATR1942_14075
Organism:  
Bacillus atrophaeus 1942
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2761583..2764120 [-1], 2538 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_003974668.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2538 bp
>BATR1942_14075|ThioFinder1173 Bacillus atrophaeus 1942
ATGGCGGAAAATGTGGCGCCGTTTGTTATGCTGCGGGCTGCAGGCGGCAGCATCGACAGTTTGAAAAGTA
TGGATATAGCAGAATCGGCAAAAAATGTTGACAAGATTCTTGATCTTGAACAAGCCCTTGAAAACTTGAA
AGAACCTTTAAGCGACATTTTTTATGAACTGATTTCCCGACTGCAGGATGAGGAAACGACGATCCTCCGT
TTTCTGCTAAAAATCAAACGGGATATTTTTAATAGCCGTGCTGTCAAGATTTCAGAAGAAAATAGAACGG
AATTAAAAAAACGAATGTCTGAAGCCGATTTTGGTTTATTTGATCAATGGTATACGGCGATTCACGACAG
ACAGACATATATGGAAGACACAAAGCAGCTTTTTGAGGAAGAAATTAAGCAGGCTGGTAAACGGTTAGCG
TATGAAATGGAAAATAAAGAATGGCAAAAAGGAATGGCGCTGGCTAATCCAAAATATTTAACCGCCTATA
AGAAAAGCAAGCCGAAATTGTGGCAGCCTCATAAACAATACGCACGCTCCAGTATGGCTTATTTAGGAAG
AATCACTGCAAAAACCAGCCCGTTCAGCACCTTTACAAAAATCGGATTGACCTCTTTTTCAGCTGATGAT
GCGCCGGCCCCCAGCACTCAGAAAACAAACTTTTGCAGCATATCCAAATCGATTTGCAGCGAACTCATTT
TTGAAATGGCACAGCATCCTGAATTTTCCCGGTACTTGCAATATGAAAAAAACCAATCTCTTCAACCAGC
AGAAAAAAACACTATACAGCTGATGAAAAGCTCTTATACGATTTTGAACGGATTTGCATGGCGGGAGGAT
AAAATGGTTTCAGAAAACGTATCAGATGAACAGATGAGTGTGATTGAGTCACTCTGTTCAGGAAGTTTCG
AGGAAGTAACGGAACTGCTGAAAAACACGTCTTTAACCATACCTTGTTTGTCAGCTGAACAATGGATCAA
ACCGGTTCTCCCCTTTTCAAGAAAATCCGAGCAGCCTTTGCTAAGTTTATACGATTTCCTTCAGCCGATA
CCTTCCCGAAAAGCAAGGCGGCTGGCGCGCATTGTGAAATGGATGGATGGCTGCATAGAGGCGCTTGCGG
CCAGTGAAGCAAAGCGAAGACTTAAGTATCACCAGCTGATTCACAGACTCGCCAAACGCGCATTCAGTGA
GCTGACACATAAGGCTCCAAAAAGCTTATTGAATGAAAAACTCGTTTATGAAAATGTGAAATTTGCCGGA
GATCATCCGCCATTAGGTGAGTATGTAAAACGTGATATGGAAAAGCTGTCTCATCAGCTCAGAAACTATC
AATTCCGCACACACCTGTACGATTTACTATGTGAGCATTTCGTAGAAACGTATGGGAGGGGAGGCGTGTG
CAGCGACATTCAAGCATTTTTGTATCAGTTTGAAAAGAGAAAAGACCGGCCGCGATTAATCAAAAACGCC
TTGCGGAAAGATAAGAAGACCGCTTTGAAACTGGAGGAGTCAAGAGTCTTTGCCCCTTATGGCGCCAGTT
CTACGCCGCCAAGCGCAACCGTTTTTTATCAGTTGGCCGCAAATAACGGCAGAGACAGCATTGCGGCTGG
AGACTACCAGTTGGTTATCAATCAAATCAGCTCCGGGCTGGGGCTGCTGCTTCGATTCCAATCTATGTTT
CAAGAGGACGGGCGGAATTTAAGCACTCTCATGAAGCAATGGGTGAATGCTATGAACCCCAGCTCAGACA
TCGTTCATTTTCCGATGATTTCAGATTTCAGCAATTTACAGACTGATCCCGGCATTACATCACAATCCTT
AAGATGGCTTGGCGAAAATCCTACATCAGACCAGAATGATATTCTATTAAAAGATCTGCTTTTGGTTCAT
GAGGATTCCGGCACGCTGGCTCTTGTAAATAAAGAAGGACGTCCTGTCGCCCCCATGTATTTCGGTGCCG
TCCCTCAGCATATGATGCACGGGCCTGTATCCTATCTGTTTACCATTATGATGCCCTGGATCAATGCTTA
TCAGGCGGATTGGGTGTCTTCTCCGTTATTTTCAAAAGCGCCTCCGCCGGAGAAAGTGGAATTTCATTCC
CGCGTGCAAGAGGGAAGAATCGTTCAAAGACGTTCCAGATGGCGGATTCCGGCTTTCTTATTCCCGCTAA
AAGAACATCGTGAAAGTGAGTATGCCTATTTTACAAGAATGAAAGCATTTCAAAAGAATTACGGACTTCC
TGATGAGGGCTTTCTTTCCGGGGAGAGGACAAGCGTCATGCTGAATCCGAAGCAAAGAAAACCGATGTAC
ATGAATTTTAATAGCTATCATTCAATAGAAGCGGCTGTGAACACGGTTGCAGCAGAAGACGATCTTTTGT
CGATTACGTTTACTGAAGCGCTGCCTGACCGGAATCAGCATTGGCTCAAGAGTGAGGAAGGGCATGTGAT
TGCGTCTGAATATATGTCCTTGTTCCAATGGCCTGGTGTGAAGCATGAAGAATCAGTTATAGCCAATCAG
AAAGGGGTTTTTATATGA
 Primer design

Protein Sequence:845 a.a.
>BATR1942_14075|ThioFinder1173 Bacillus atrophaeus 1942
MAENVAPFVMLRAAGGSIDSLKSMDIAESAKNVDKILDLEQALENLKEPLSDIFYELISRLQDEETTILR
FLLKIKRDIFNSRAVKISEENRTELKKRMSEADFGLFDQWYTAIHDRQTYMEDTKQLFEEEIKQAGKRLA
YEMENKEWQKGMALANPKYLTAYKKSKPKLWQPHKQYARSSMAYLGRITAKTSPFSTFTKIGLTSFSADD
APAPSTQKTNFCSISKSICSELIFEMAQHPEFSRYLQYEKNQSLQPAEKNTIQLMKSSYTILNGFAWRED
KMVSENVSDEQMSVIESLCSGSFEEVTELLKNTSLTIPCLSAEQWIKPVLPFSRKSEQPLLSLYDFLQPI
PSRKARRLARIVKWMDGCIEALAASEAKRRLKYHQLIHRLAKRAFSELTHKAPKSLLNEKLVYENVKFAG
DHPPLGEYVKRDMEKLSHQLRNYQFRTHLYDLLCEHFVETYGRGGVCSDIQAFLYQFEKRKDRPRLIKNA
LRKDKKTALKLEESRVFAPYGASSTPPSATVFYQLAANNGRDSIAAGDYQLVINQISSGLGLLLRFQSMF
QEDGRNLSTLMKQWVNAMNPSSDIVHFPMISDFSNLQTDPGITSQSLRWLGENPTSDQNDILLKDLLLVH
EDSGTLALVNKEGRPVAPMYFGAVPQHMMHGPVSYLFTIMMPWINAYQADWVSSPLFSKAPPPEKVEFHS
RVQEGRIVQRRSRWRIPAFLFPLKEHRESEYAYFTRMKAFQKNYGLPDEGFLSGERTSVMLNPKQRKPMY
MNFNSYHSIEAAVNTVAAEDDLLSITFTEALPDRNQHWLKSEEGHVIASEYMSLFQWPGVKHEESVIANQ
KGVFI